showing 36 of ~574560 from 574555 documents

Zemes mākslīgo pavadoņu novērošanas stacijas dežūru žurnāls Nr. 1, 1957–1958

2023

Raksts tapis par PSRS izgudrotu Zemes mākslīgo pavadoņu novērošanas stacijas dežūru žurnālu, kur uzskaitītas iesaistītās personas - pasniedzēji, zinātniskie asistenti un studenti no Pētera Stučkas Latvijas Valsts universitātes (LVU) Fizikas un matemātikas fakultātes. Novērošanas stacija atradās LVU Botāniskajā dārzā, kur bija iespējams veikt astronomiskos novērojumus. Lai kādas bija ieceres novērošanas stacijas attīstībai, studentu interese noplaka interešu trūkuma dēļ. Zemes mākslīgo pavadoņu novērošanas stacijas dežūru žurnāls Nr. 1, 1957–1958 pievienots atsevišķā datnē.

Latvijas Universitāte:NATURAL SCIENCES::Physics::Astronomy and astrophysics::Astronomy [Research Subject Categories]AstronomyLatvijas zinātneUniversity of Latvia Botanical GardenLU Botāniskais dārzsThe University of LatviaZemes mākslīgo pavadoņu novērošanaAstronomija

Z-Scan theory for thin film measurements: Validation of a model beyond the standard approach using ITO and HfO2

2023

The Z-Scan technique is an easy and widespread approach to evaluate the nonlinear optical coefficient of materials. However, the evaluation of the same coefficients for thin films requires complex experimental setups that allow to remove the contributions of the substrate. Here, we propose a simple, yet effective, theoretical approach that allows to include the substrate contribution to the focusing effect when scanning along the propagation axis. The proposed method therefore removes the need of complex experimental setups and paves the way for a simpler retrieval of optical properties of complex nanostructures.

Nonlinear opticsZ-ScanHafniaSettore ING-INF/02 - Campi ElettromagneticiITO

The role of career adaptability resources in dual career pathways: A person-oriented longitudinal study across elite sports upper secondary school

2023

Objectives Obtaining education is an important milestone in athletes’ preparation for their professional career after sport. Literature indicates that combining school and sport is not an easy task for many aspiring youth athletes. It has been proposed that career adaptability, which refers to psychosocial resources enabling individuals to solve complex occupational transitions, present and anticipated vocational development tasks, and career related challenges could be a relevant concept for applied work with student-athletes. In this study, we examined whether there are distinct developmental profiles of career adaptability among adolescent athletes across the upper secondary school years…

opintomenestyssopeutuminenlongitudinal researchkilpaurheilupitkittäistutkimusurheilulukiotacademic achievementurheilu-uranuoretcareer adaptabilityopiskelusport withdrawalyouth sportApplied PsychologyurheilijatPsychology of Sport and Exercise

Welfare effects of environmental hypercapnia quantified by indicators based on morphology and allostatic load in Atlantic salmon (Salmo salar)

2023

Water supply is a limited resource in most salmon hatcheries, which is compensated by reduced water flow and oxygenation. However, reduced water exchange can lead to accumulation of CO2, resulting in environmental hypercapnia, which may have negative impacts on fish welfare. Thus, environmental hypercapnia can be a common welfare problem for salmon in hatcheries, and particularly in recirculating systems (RAS). In this experiment, Atlantic salmon were exposed to chronic environmental hypercapnia during the last 68 days of the freshwater phase, whereupon effects on physiological stress coping mechanisms and morphological welfare indicators were investigated. Effects on stress coping mechanis…

Aquatic ScienceVDP::Landbruks- og Fiskerifag: 900::Fiskerifag: 920

Unsupervised representation learning of spontaneous MEG data with nonlinear ICA

2023

Funding Information: We wish to thank the reviewers and editors for the useful comments to improve the paper a lot. We thank Dr. Hiroshi Morioka for the useful discussion at the beginning of the project. L.P. was funded in part by the European Research Council (No. 678578 ). A.H. was supported by a Fellowship from CIFAR, and the Academy of Finland. The authors acknowledge the computational resources provided by the Aalto Science-IT project, and also wish to thank the Finnish Grid and Cloud Infrastructure (FGCI) for supporting this project with computational and data storage resources. | openaire: EC/H2020/678578/EU//HRMEG Resting-state magnetoencephalography (MEG) data show complex but stru…

neuropalautenon-stationarityMEGsignaalinkäsittelyCognitive Neurosciencesyväoppiminensignaalianalyysineurofeedbackunsupervised learningdeep generative modelkoneoppiminenNeurologyresting-state networkmagnetoencephalography (MEG)nonlinear independent component analysis (ICA)NeuroImage

Sectoral policies as drivers of forest management and ecosystems services: A case study in Bavaria, Germany

2023

European countries have national sectoral polices to regulate and promote the provision of a wide range of forest ecosystems services (FES). However, potential incoherencies among these policies can negatively affect the efficient provision of FES. In this work, we evaluated the coherence among three national policies from Germany and their ability to effectively provide FES in the future: the Forest Strategy 2020 (FS), the National Strategy on Biological Diversity (BDS), and the German National Policy Strategy on Bioeconomy (BES). Using forest inventory data from the Federal State of Bavaria, we simulated a range of forest management options under three climate trajectories for 100 years i…

metsänkäsittelyGeography Planning and Developmentforest managementForestryforest policyscenario analysisilmastonmuutoksetManagement Monitoring Policy and Lawskenaariotmonitavoiteoptimointibiodiversiteetticlimate changeekosysteemipalvelutmulti-objective optimizationmetsäpolitiikkabiodiversityNature and Landscape ConservationLand Use Policy

Small-time bilinear control of Schrödinger equations with application to rotating linear molecules

2023

In [14] Duca and Nersesyan proved a small-time controllability property of nonlinear Schrödinger equations on a d-dimensional torus $\mathbb{T}^d$. In this paper we study a similar property, in the linear setting, starting from a closed Riemannian manifold. We then focus on the 2-dimensional sphere $S^2$, which models the bilinear control of a rotating linear top: as a corollary, we obtain the approximate controllability in arbitrarily small times among particular eigenfunctions of the Laplacian of $S^2$.

FOS: Physical sciencesSchrödinger equation[MATH.MATH-OC] Mathematics [math]/Optimization and Control [math.OC]Mathematical Physics (math-ph)infinite-dimensional systemsOptimization and Control (math.OC)Control and Systems Engineeringbilinear systemsFOS: Mathematicslinear molecule[MATH.MATH-AP] Mathematics [math]/Analysis of PDEs [math.AP][MATH.MATH-MP] Mathematics [math]/Mathematical Physics [math-ph]Electrical and Electronic EngineeringQuantum Physics (quant-ph)small-time controllability[PHYS.QPHY] Physics [physics]/Quantum Physics [quant-ph]Analysis of PDEs (math.AP)Automatica

Are climate change policies politically costly?

2023

Are policies designed to avert climate change (Climate Change Policies, or CCPs) politically costly? Using data on governmental popular support and the OECD's Environmental Stringency Index covering 30 countries between 2001 and 2015, our results show that CCPs are not necessarily politically costly: policy design matters. First, in contrast to non-market-based CCPs (such as emission limits), only market-based CCPs (such as emission taxes) entail political costs for the government. Second, the effects are only present when CCPs are adopted during periods of high oil prices, prior to elections, or in countries depending strongly on non-green (dirty) energy sources. Third, CCPs are only polit…

General EnergyClimate change policiesClimate changePolitical supportPolitical costGeneral Earth and Planetary SciencesJ Political ScienceManagement Monitoring Policy and LawGeneral Environmental ScienceGE Environmental Sciences

A bibliometric review of sukuk literature

2023

Abstract Sukuk (Islamic bonds) are one of the Islamic finance sectors that have experienced the fastest growth during the last decade. Using a quali-quantitative approach known as meta-literature review, the aim of this paper is to survey the sukuk literature over the period 1950–2018. In total we review and analyze 80 papers through bibliometric citation analysis (using HistCite and VOSviewer software) coupled with content analysis. We show the influential aspects of the literature, such as countries, institutions, journals, authors, articles and topics. We also present the co-authorship network and identify three research streams: (1) sukuk overview and growth, (2) sukuk and finance theor…

Islamic financeSukukEconomics and Econometrics050208 financebusiness.industrySukuk Islamic bonds Islamic finance Meta-literature review Bibliometric citation analysis Bibliometric cartography analysisBond05 social sciencesIslamAccountingSukukIslamic financeSettore SECS-P/11 - ECONOMIA DEGLI INTERMEDIARI FINANZIARIBibliometric citation analysisMeta-literature reviewCitation analysisOrder (exchange)Content analysis0502 economics and businessStock marketBusiness050207 economicsBibliometric cartography analysisIslamic bondsFinance

From treatment of mental disorders to the treatment of difficult life situations: A hypothesis and rationale

2023

The group-level symptom-reduction model of mental health care emphasizes predetermined treatment guidelines for those mental and social difficulties that are diagnosable as mental health disorders on the basis of predetermined diagnostic criteria. The model have produced generalizable information to support medical decision-making for symptom reduction. However, it may have also increased the reification of diagnostic labels, and in so doing medicalized and stigmatized complex human-life experiences, with a lack of attention to a range of social determinants and existential factors associated with mental health. Since symptom-reduction model can easily lose sight of essential non-technical …

open dialoguepsychiatric servicesGeneral Medicinepsychiatryelämäntilannemielenterveyspsykiatrinen hoitomielenterveyshäiriöthoitomenetelmätvaikeudetontologymielenterveyspalvelutmental healthsosioekonomiset tekijätMedical Hypotheses

Differential associations of leisure music engagement with resilience : A network analysis

2023

Background/Objective Several factors associated with resilience as the maintenance of mental health despite stress exposure can be strengthened through participation in leisure time activities. Since many people listen to or make music in their leisure time, the aim of the present study was to provide insights into the architecture of how resilience relates to passive and active music engagement. Method 511 participants regularly listening to and/or making music completed an online survey on resilient outcomes (i.e., mental health and stressor recovery ability), different resilience factors (e.g., optimism, social support), quantitative music engagement (i.e., time spent with music listenin…

resilienssimielialamusiikkieveryday lifemusiikkipsykologiastressiarkielämäClinical Psychologystressmielenterveysmusiikin harrastaminenmood regulationmusic listeningmental healthmusic making

Performance-based research funding: Evidence from the largest natural experiment worldwide

2023

A performance-based research funding system (PRFS) is a nationwide incentive scheme that promotes and rewards university research performance through competition for government funding. The UK’s PRFS, currently the Research Excellence Framework (REF), is considered the oldest, largest and most developed payment-by-results system in academia worldwide. Surprisingly, and despite the strong criticisms, little has been done to quantitatively and casually evaluate the intended and unintended effects of the PRFSs. In this paper, we evaluate the incremental impact of the REF 2014 in the fields of Economics and Business. We use a synthetic control method to compare the performance of UK universitie…

Research Excellence FrameworkSynthetic control methodResearch policySettore SECS-S/06 -Metodi Mat. dell'Economia e d. Scienze Attuariali e Finanz.Management of Technology and InnovationStrategy and ManagementPerformance-based research funding systemManagement Science and Operations ResearchResearch productivityResearch Policy

Donne e codici nell’Italia preunitaria

2023

Spousal power in the codes and nineteenth-century legal reflection - (Mutual?) rights and duties - The debate on coercive measures to protect the "conjugal home" - Marital incapacity - (In)equal spouses: separation in French and Bourbonic codification.

Settore IUS/19 - Storia Del Diritto Medievale E ModernoCode19th centuryhistory of lawWomenPre-Unification Italywomen legal historymarriage

In-beam test results of the Super-FRS GEM-TPC detector prototype with relativistic uranium ion beam

2023

As an essential part of the Super-FRS particle identification, the GEM-TPC detector in a twin field-cage configuration will provide position information at up to 1 MHz counting rate with a spatial resolution 95 %. This detector is designed to provide particle-beam tracking information of projectiles ranging from protons to uranium. The performance of the GEM-TPC detector in a single field-cage configuration and newly integrated AWAGS readout electronics with a differential output was studied at the FRS for the response to the uranium beam at 850 MeV/u with intensity up to 1000 ions/spill. The result shows that a clusterization algorithm developed for this analysis works properly. The spatia…

clusterizationNuclear and High Energy Physicsilmaisimetsuper-FRStutkimuslaitteettrackingydinfysiikka114 Physical sciencesGEM-TPCInstrumentationFAIRNuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment

Calibration of the PREdiction of DELIRium in ICu Patients (PRE-DELIRIC) Score in a Cohort of Critically Ill Patients: A Retrospective Cohort Study

2023

BACKGROUND: To predict delirium in intensive care unit (ICU) patients, the Prediction of Delirium in ICU Patients (PRE-DELIRIC) score may be used. This model may help nurses to predict delirium in high-risk ICU patients. OBJECTIVES: The aims of this study were to externally validate the PRE-DELIRIC model and to identify predictive factors and outcomes for ICU delirium. METHOD: All patients underwent delirium risk assessment by the PRE-DELIRIC model at admission. We used the Intensive Care Delirium Screening Check List to identify patients with delirium. The receiver operating characteristic curve measured discrimination capacity among patients with or without ICU delirium. Calibration abili…

Nursing PREDELIRIC Calibration ICUEmergency NursingCritical Care NursingSettore MED/45 - Scienze Infermieristiche Generali Cliniche E Pediatriche

Using the centre-periphery framework to explore human-carnivore relations

2023

Unidad de excelencia María de Maeztu CEX2019-000940-M Living alongside carnivores can incur both costs and benefits on people's lifeways. While positive outcomes of carnivore presence can foster coexistence, negative relations with carnivores can trigger carnivores' killing and undermine their conservation. In response to this, conservation efforts increasingly focus on promoting positive human-carnivore relations, most often through improvements in the flow of economic benefits from carnivores to local communities. However, there is a question mark over the effectiveness and potential consequences of market-based instruments for carnivore conservation. To understand the opportunities and p…

lajiensuojelu119 Other natural sciencesCentre-periphery frameworkConservationPE&RCBenefitsrinnakkaiseloHuman-carnivore relationstaloudelliset vaikutuksetCarnivoresWildlife Ecology and ConservationLife Scienceihminen-eläinsuhdeperiferiatsuurpedot1172 Environmental sciencesEcology Evolution Behavior and SystematicsNature and Landscape Conservation

How does university teachers’ pedagogical training meet topical challenges raised by educational research? A case study from Finland

2023

Through a literature review, this study identified research themes related to university pedagogy and examined how these themes appear in the curricula of university pedagogy courses and in the experiences of the participants and trainers of these courses at a Finnish research university. The literature review produced a multidimensional model of the relationships between identified themes, which can be used as an analytical tool for examining pedagogical training. Analysis of the courses revealed a need to broaden the understanding of the course contents and practices and their alignment to global, societal, and labour-market needs. peerReviewed

pedagogiikkaammatillinen kehityshigher educationcurriculum designosaamisen kehittäminenacademicspedagogical trainingopettajatyliopistopedagogiikkaprofessional developmentkorkeakouluopetusopetussuunnitelmatEducationTeaching and Teacher Education

The linearized Calderón problem for polyharmonic operators

2023

In this article we consider a linearized Calderón problem for polyharmonic operators of order 2m (m ≥ 2) in the spirit of Calderón’s original work [7]. We give a uniqueness result for determining coefficients of order ≤ 2m − 1 up to gauge, based on inverting momentum ray transforms. peerReviewed

osittaisdifferentiaaliyhtälötCalderón problemApplied MathematicsFOS: Mathematicstensor tomographymomentum ray transformpotentiaaliteoria35R30 31B20perturbed polyharmonic operatorinversio-ongelmatAnalysisanisotropic perturbationAnalysis of PDEs (math.AP)

Applicability of hybrid aspen (Populus tremula L. × P. tremuloides Michx.) bark extract as a precursor of rigid carbon foam and activated carbon

2023

Hybrid aspens have long attracted scientific interest, but the research on their use as feedstocks for chemical applications are still very limited. The bark biomass of the poplar species contains many valuable extractives that can be utilized as value-added products. This paper examines the applicability of hybrid aspen (Populus tremula L. × P. tremuloides Michx.) bark extract as a precursor of rigid carbon foam and activated carbon. To explore this, the study considers 1) the basic chemical composition of the bark in terms of added value potential, 2) the basic chemical composition of the bark extract and the effect of its pretreatment on the extract composition, 3) the production of rigi…

uutteetpuunkuoriRenewable Energy Sustainability and the Environmentbark extractiveForestrytremulatremuloidesrigid carbon foamuuttoXAD7HP-purificationaktiivihiiliactivated carbonbiomassa (teollisuus)Waste Management and DisposalAgronomy and Crop Sciencehybridihaapa

Occupancy, density, and activity patterns of a Critically Endangered leopard population on the Kawthoolei‐Thailand border

2023

Large carnivores have been largely extirpated from Southeast Asia due to deforestation, habitat fragmentation, and poaching. Estimating the density of endangered carnivore populations, and identifying relationships between species occupancy and both environmental and anthropogenic factors, is essential for effective conservation planning. Recently, the IUCN conservation status of the Indochinese leopard (Panthera pardus delacouri) was upgraded to "Critically Endangered. " We surveyed Kweekoh Wildlife Sanctuary in Kawthoolei, an area administered by the Karen ethnic group in eastern Myanmar, to quantify (1) leopard population density using spatially explicit mark-resight (SMR) models, (2) le…

Panthera parduscarnivoreKaren StateSettore BIO/05 - Zoologiaspatially explicit capture-recapture (SECR)MyanmarEcology Evolution Behavior and SystematicsPopulation Ecology

Experimental Tests to Validate a Simple Procedure to Design Dual-Diameter Drip Laterals on Flat Fields

2023

Multiple-diameter laterals reduce the total cost in microirrigation systems, however, the length of each sublateral should be determined carefully to assure appro-priate performance of emitter flow rates. The most accurate method is the numerical trial and error, which is time-consuming. A series of research efforts have been made to propose simple analytical design procedures. By using the power-law form of the Darcy-Weisbach formula, and equal emitters spacing for the sublaterals, Sadeghi et al. (Sadeghi et al. in J Irrig Drain E-ASCE 142:04,016,020, 2016) extended a previously introduced design solution for one-diameter laterals to tapered laterals. Recently, a simplified procedure to de…

Tapered lateralDual-diameter drip lateralSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-ForestaliAnalytical solutionsFlow rate experimental measurement

A review on the advancements in the characterization of the high-pressure properties of iodates

2023

The goal of this work is to report a systematic and balanced review of the progress made in recent years on the high-pressure behavior of iodates, a group of materials with multiple technological applications and peculiar behaviors under external compression. This review article presents results obtained from multiple characterization techniques which include: X-ray diffraction, Raman and infrared spectroscopy, optical-absorption, resistivity, and second-harmonic generation measurements. The discussion of the results from experiments will be combined with density-functional theory calculations which have been shown to be a very useful tool for the interpretation of experimental data. Throug…

Condensed Matter - Materials ScienceMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciencesGeneral Materials ScienceProgress in Materials Science

Activated Cashew Carbon-Manganese Oxide Based Electrodes for Supercapacitor Applications

2023

The current global energy challenge which affects most developing countries in particular, is of major source of concern today. The availability of less expensive techniques of storing excess generated energy is critical to the success of the renewable energy roadmaps implementation. In this study, hydrothermal and chemical leaching methods have been used to synthesize MnO2 nanoparticles using KMnO4 and MnSO4 as precursors at 140 °C and from natural local manganese ore. Activated Carbon (ACF) have also been produced from agricultural Cashew biomass waste, through a physical carbonization and KOH activation process using temperatures of 700 °C – 900 °C for periods between 1-2 hours. The as-p…

Multidisciplinaryelectrochemistrymaatalousjätteetaktiivihiilisuperkondensaattoritelektroditactivated carboncharacterizationsupercapacitorbiomassa (teollisuus)agrowastesähkökemia

An Innovative Soil Bioengineering Technique by Waste Materials: The RiVite Project

2023

This paper describes the RiVite project granted by the Italian Ministry of Economic Development according to the JUMP (Joint Universities Program for PoC) program for patents enhancement, proposed by Sant’Anna School, Scuola Normale and the University of Palermo. The patent (Calvo, R., D’Asaro, F., Baiamonte, G.: Metodo per la realizzazione di un’opera costruttiva modulare per la protezione del territorio e detta opera. Attestato di Brevetto per Invenzione Industriale, n° 102,017,000,141,369, Ministero dello Sviluppo Economico, Roma, 27/02/2020.) consists of an advanced soil bioengineering work providing anti-erosion function, consolidating and stabilizing of slopes, thus for land protectio…

Vine shootVine pruningPosidonia oceanica residuesSoil bioengineering techniqueSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-Forestali

Plant Extracts as Antimicrobial Agents in Sustainable Conservation of Erythrina caffra (Fabaceae) Historical Trees

2023

Microbial colonization plays a relevant role in the biodegradation and biodeterioration of cultural and natural heritage, representing a revealing problem in conservation strategy. In this study, the essential oil (EO) and hydro-alcoholic extract (HAE) of Origanum vulgare L. (Lamiaceae), an aromatic perennial plant, representative of the Mediterranean basin, growing spontaneously and cultivated all over the world, were analysed. Natural products, such as essential oil and hydroalcoholic extract, have strong antiseptic and antimicrobial properties and are ad hoc applied for the sustainable conservation of Erithryna caffra (Fabaceae). The main taxa revealed in the damaging of these arboreal h…

antimicrobial activitysustainable conservationnatural heritageSettore BIO/03 - Botanica Ambientale E Applicatahydro-alcoholic extractessential oilurban historical tree

Comparison of the P-integral with Burkill's integrals and some applications to trigonometric series

2023

It is proved that the $P_r$-integral [9] which recovers a function from its derivative defined in the space $L^r$, 1 ≤r<∞, is properly included in Burkill’s trigonometric CP-and SCP-integrals. As an application to harmonic analysis, a de La Vallée-Poussin-type theorem for the $P_r$-integral is obtained: convergence nearly everywhere of a trigonometric series to a $P_r$-integrable function f implies that this series is the Pr-Fourier series of f.

Settore MAT/05 - Analisi MatematicaApplied MathematicsNon-absolute integral Derivative in $L^r$ Perron-type integral Cesaro-Perron integral Trigonometric series Fourier coefficients.AnalysisJournal of Mathematical Analysis and Applications

Design and model test of a soft-connected lattice-structured floating solar photovoltaic concept for harsh offshore conditions

2023

Various types of floating solar photovoltaic (FPV) devices have been previously proposed, designed and constructed with applications primarily limited to onshore water bodies or nearshore regions with benign environmental conditions. This paper proposes a novel FPV concept which can survive harsh environmental conditions with extreme wave heights above 10 m. This concept uses standardised lightweight semi-submersible floats made of circular materials as individual modules. The floating modules are soft connected with ropes to form an FPV array. We first present the conceptual design of the floats and the connection systems, including hydrostatic, hydrodynamic, and structural assessments of …

Mechanics of MaterialsMechanical EngineeringOcean EngineeringGeneral Materials ScienceVDP::Teknologi: 500::Informasjons- og kommunikasjonsteknologi: 550Marine Structures

With great power comes great responsibilities – Examining platform-based mechanisms and institutional trust in rideshare services

2023

From the perspective of female passengers, much remains unknown about institutional or platform trust and the sharing economy. The present study was conducted in an emerging economy context to comprehend the significance of institutional trust. The study aimed to develop a dynamic theoretical model incorporating the perceived effectiveness of platform-based institutional structures (PEPIS) as a dependent variable in sharing economy platforms, examine the antecedents of PEPIS and determine how PEPIS affects female passengers' trust in the institution or platform. Different strata of female passengers were targeted using a quota-cum-purposive sampling method. In total, 413 useable responses t…

Marketingnaisetalustatalousrescue mechanismsubjective well-beingluottamusrideshareinstitutional trustkimppakyytikäyttäjäkokemusfeedback mechanismkoettu hyvinvointijakamistalousJournal of Retailing and Consumer Services

Photonic controlled metasurface for intelligent antenna beam steering applications including 6G mobile communication systems

2023

This paper presents a novel metasurface antenna whose radiation characteristics can be remotely controlled by optical means using PIN photodiodes. The proposed reconfigurable antenna is implemented using a single radiating element to minimize the size and complexity. The antenna is shown to exhibit a large impedance bandwidth and is capable of radiating energy in a specified direction. The proposed antenna consists of a standard rectangular patch on which is embedded an H-tree shaped fractal slot of order 3. The fractal slot is used to effectively reduce the physical size of the patch by 75 % and to enhance its impedance bandwidth. A metasurface layer is strategically placed above the patch…

Photonic systemsReconfigurable devicesBeam steeringMetasurfaceElectrical and Electronic EngineeringPatch antennaFractal geometries

Self-Heating Induced Instability of a Non-Linear Inductor in a SMPS: a Case Study

2023

This paper proposes a case study to show that the non-linear operation of a power inductor in a SMPS can induce instability of the control system leading to overheating of the inductor beyond its allowable temperature and to an excessive peak of the maximum current. The case study is performed by a commercial ferrite inductor employed in a synchronous boost converter encompassing a control system to adjust the duty cycle, assuring a constant output voltage. The thermal transient is described by the time domain waveforms and thermal images.

Non-linear inductor ferrite inductor magnetic saturation stability power density switched mode power supplySettore ING-INF/01 - Elettronica

High-density single nucleotide polymorphism markers reveal the population structure of 2 local chicken genetic resources

2023

Italy counts a large number of local chicken populations, some without a recognized genetic structure, such as Val Platani (VPL) and Cornuta (COS), which represent noteworthy local genetic resources. In this study, the genotype data of 34 COS and 42 VPL, obtained with the Affymetrix Axiom600KChicken Genotyping Array, were used with the aim to investigate the genetic diversity, the runs of homozygosity (ROH) pattern, as well as the population structure and relationship within the framework of other local Italian and commercial chickens. The genetic diversity indices, estimated using different approaches, displayed moderate levels of genetic diversity in both populations. The identified ROH h…

Settore AGR/17 - Zootecnica Generale E Miglioramento Geneticolocal populationconservation genetic diversity inbreeding local population SNPconservationSNPinbreedingAnimal Science and ZoologyGeneral Medicinegenetic diversitySNP genetic diversity local population inbreeding conservation

Circular economy and agritourism: a sustainable behavioral model for tourists and farmers in the post-COVID era.

2023

Introduction: In recent years, issues related to environmental and ecosystem protection have been given greater consideration than in the past. The goal of adopting sustainable development models is vigorously pursued in the European Union and is reflected concretely in the new Common Agricultural Policy 20232027. The circular economy can certainly be an emerging economic response that can eectively replace growth models centered on a linear view. Agriculture and tourism are two crucial sectors where the “green transition” should be encouraged to help achieve sustainability goals through economic circularity. Agritourism’s activity may be relevant in contributing to a behavioral change based…

sustainable development rural tourism multifunctional agriculture CAP sampling survey green transition European funding agri-food system

Carbon Emissions Announcements and Market Returns

2023

The paper investigates the impact of carbon emissions on stock price returns of European listed firms. This relationship is assessed across all three emissions scopes, as well as using expecta-tions to detect if future emissions impact contemporary returns. Our findings show that firms with higher expected future emissions deliver contemporary lower returns, after controlling for market capitalization, profit, and other known return predictors. This result is statistically sig-nificant in the post Paris Agreement period with a two to three years expectation on scope 2 emissions. However, there is marginal to no significant negative relationship between current emissions and current returns.…

Settore SECS-S/06 -Metodi Mat. dell'Economia e d. Scienze Attuariali e Finanz.emissionequity returnParis agreementenvironmental sentiment

STUDY OF SMALL MOLECULES IN THE FIGHT AGAINST NONSENSE AND SPLICING MUTATIONS THAT CAUSE CYSTIC FIBROSIS.

2023

OrganoidNonsense mutationTranslational readthroughCystic fibrosiMicrosomeCFTRTRIDSplicing mutationkinetinRECTAS

New national and regional Annex I Habitat records: from #60 to #82

2023

New Italian data on the distribution of the Annex I Habitats are reported in this contribution. Specifically, 8 new occurrences in Natura 2000 sites are presented and 49 new cells are added in the EEA 10 km × 10 km reference grid. The new data refer to the Italian administrative regions of Campania, Calabria, Marche, Piedmont, Sardinia, Sicily, Tuscany and Umbria. Relevés and figures are provided as Supplementary material respectively 1 and 2.

2250*1240 1310 1420 2250* 3130 3220 3260 3270 3280 4090 6110* 6430 7210* 8210 91AA* 91B0 91E0* 92A0 92D0 933091AA*92D01310142091B03270328032607210*933031308210124032206430Settore BIO/03 - Botanica Ambientale E Applicata409091E0*6110*92A0

Riflessioni e traiettorie di ricerca interdisciplinari sulla transizione ecologica

2023

Il volume 13 di AGATHÓN segue il precedente sulla Innovability©® | Transizione Digitale e raccoglie saggi e ricerche su Innovability©® | Transizione Ecologica, consapevole della sua incalzante attualità, ma anche del portato che la proposta di una doppia chiave di interpretazione suggerisce. I contributi del volume ci consegnano riflessioni e traiettorie di ricerca basate sulla necessità di una natura multiscalare degli interventi, che garantisca effetti indotti a un contesto ambientale più ampio di quello di riferimento, e di team che affrontino le criticità con un approccio collaborativo inter e transdisciplinare olistico e sistemico, in una sorta di speciazione delle discipline che ne mo…

ecological transitiontransizione ecologicaSettore ICAR/12 - Tecnologia Dell'Architettura