showing 36 of ~574560 from 574555 documents

Accuracy of different cutoffs of the waist‐to‐height ratio as a screening tool for cardiometabolic risk in children and adolescents: A systematic rev…

2021

The present systematic review with meta-analysis sought to estimate the accuracy of different waist-to-height ratio (WHtR) cutoff ranges as risk indicators for cardiometabolic health in different populations of children and adolescents. Systematic searches were undertaken to identify studies in apparently healthy participants aged 3–18 years that conducted receiver operating characteristic curve analysis and reported area under the receiver operating characteristic curves for WHtR with any cardiometabolic biomarker. Forty-one cross-sectional studies were included in the meta-analysis, including 138,561 young individuals (50% girls). Higher area under summary receiver operating characteristi…

Maleanthropometric indexreceiver-operating characteristic curveAdolescentEndocrinology Diabetes and MetabolismSoutheast asianmetabolic syndromeBody Mass IndexRisk FactorsHumansMedicineCutoffScreening toolChildMetabolic SyndromeCardiometabolic riskWaist-to-height ratioWaist-Height RatioReceiver operating characteristicDiagnostic Tests Routinebusiness.industryPublic Health Environmental and Occupational HealthDiagnostic testCross-Sectional Studiesdiagnostic testCardiovascular DiseasesChild PreschoolMeta-analysisFemaleWaist CircumferencebusinessDemographyObesity Reviews

Relationship between Perception and Socio-Economic Characteristics of Culture Community in the Development of Marine Ecotourism in Nusmapi Island

2021

Marine tourism is a type of special interest tourism, namely by managing and utilizing marine and coastal landscapes, both those that are managed directly such as swimming, boating, snorkeling, diving, or indirectly such as picnics and beach sports. Nusmapi Island has the potential to be developed as a marine tourism object which has the potential for waters and coral reefs that are in good condition. The purpose of this study was to determine the relationship between the level of public perception and the socio-economic conditions of the local community on Nusmapi Island. In October-November 2020 this research was carried out on Nusmapi Island, Manokwari Regency. The descriptive explorator…

Variablesbusiness.industrymedia_common.quotation_subjectRegression analysisSnorkelingSpecial Interest GroupLocal communityGeographyEcotourismPerceptionbusinessSocioeconomicsTourismmedia_commonJurnal Sumberdaya Akuatik Indopasifik

Synthesis, structure, properties and antimicrobial activity of para trifluoromethyl phenylboronic derivatives

2021

The [2-formyl-4-(trifluoromethyl)phenyl]boronic acid as well as its benzoxaborole and bis(benzoxaborole) derivatives were obtained and their properties studied. The 2-formyl compound displays an unusual structure in the crystalline state, with a significant twist of the boronic group, whereas in DMSO solution it tautomerizes with formation of a cyclic isomer. All the studied compounds exhibit relatively high acidity as well as a reasonable antimicrobial activity. Docking studies showed interactions of all the investigated compounds with the binding pocket of Candida albicans LeuRS. High activity against Bacillus cereus was determined for the 2-formyl compound as well as for the novel bis(be…

BenzoxaboroleBis(benzoxaborole)Antifungal AgentsDose-Response Relationship DrugMolecular StructurePhenyl boronicOrganic ChemistryMicrobial Sensitivity TestsAntifungalBiochemistryTrifluoromethylAnti-Bacterial AgentsDockingAntibacterialStructure-Activity RelationshipBacillus cereusDrug DiscoveryCandida albicansEscherichia coliLeuRSAspergillus nigerMolecular BiologyBioorganic Chemistry

Towards comprehensive non-target screening using heart-cut two-dimensional liquid chromatography for the analysis of organic atmospheric tracers in i…

2021

Abstract Non-target screening of secondary organic aerosol compounds in ice cores is used to reconstruct atmospheric conditions and sources and is a valuable tool to elucidate the chemical profiles of samples with the aim to obtain as much information as possible from one mass spectrometric measurement. The coupling of mass spectrometry to chromatography limits the results of a non-target screening to signals of compounds within a certain polarity range based on the utilized stationary phases of the columns. Comprehensive two-dimensional liquid chromatography (LCxLC) introduces a second column of different functionality to enable the analysis of a broader range of analytes. Conventional LCx…

AerosolsDetection limitChromatography Reverse-PhaseAnalyteChromatographyChemistryHydrophilic interaction chromatographyOrganic ChemistryGeneral MedicineRepeatabilityMass spectrometrySnowBiochemistryMass SpectrometryAnalytical ChemistryAerosolVolume (thermodynamics)Hydrophobic and Hydrophilic InteractionsChromatography LiquidJournal of Chromatography A

Anodische dehydrierende Cyaniminierung von Thioethern: eine einfache und nachhaltige Synthese von N ‐Cyansulfiliminen

2021

Green chemistryScope (project management)Simple (abstract algebra)ChemistryGeneral MedicineElectrochemistryCombinatorial chemistryAnodeAngewandte Chemie

The trace fossil gyrochorte: ethology and paleoecology

2021

Specimens of the trace fossil Gyrochorte from the Ordovician, Jurassic and Cretaceous of Utah, and the Pliocene of Spain are described. These occurrences expand the stratigraphic range of the ichnogenus, and allow for a re­examination of this paleoenvironmentally sensitive and puzzling trace fossil. The recognition of the penetrative characteristic of the trace is essential for a correct identification, as some trace fossils have been erroneously ascribed to Gyrochorte in the past. The producer must have been a detritus-feeding worm-like animal, probably an annelid,  that created a bilobed, vertically penetrating and sometimes plaited meandering trace. Gyrochorte typically occurs in sandy f…

FodinichniaTrace (semiology)trace fossils gyrochorte ethologyPaleontologyRange (biology)FaciesOrdovicianPaleoecologyPaleontologyTrace fossilBiologyQE701-760CretaceousSpanish Journal of Palaeontology

Unexpected formation of a dodecanuclear {CoII6CuII6} nanowheel under ambient conditions: magneto-structural correlations.

2021

We report the unique heterobimetallic dodecanuclear oxamate-based {CoII6CuII6} nanowheel obtained using an environmentally friendly synthetic protocol. The effective Hamiltonian methodology employed herein allows the rationalisation of magnetic isotropic or anisotropic metal clusters, being a significant advance for future studies of exciting properties only observed at low and ultralow temperatures.

Inorganic ChemistryMaterials scienceFuture studiesChemical physicsIsotropyAnisotropyMagnetoEnvironmentally friendlyHamiltonian (control theory)Metal clustersDalton transactions (Cambridge, England : 2003)

The K63 deubiquitinase CYLD modulates autism-like behaviors and hippocampal plasticity by regulating autophagy and mTOR signaling.

2021

Nondegradative ubiquitin chains attached to specific targets via Lysine 63 (K63) residues have emerged to play a fundamental role in synaptic function. The K63-specific deubiquitinase CYLD has been widely studied in immune cells and lately also in neurons. To better understand if CYLD plays a role in brain and synapse homeostasis, we analyzed the behavioral profile of CYLD-deficient mice. We found that the loss of CYLD results in major autism-like phenotypes including impaired social communication, increased repetitive behavior, and cognitive dysfunction. Furthermore, the absence of CYLD leads to a reduction in hippocampal network excitability, long-term potentiation, and pyramidal neuron s…

MaleAutism Spectrum DisorderNerve Tissue ProteinsHippocampal formationHippocampusDeubiquitinating enzymeSynapseMiceUbiquitinAutophagyAnimalsAutistic DisorderMechanistic target of rapamycinPI3K/AKT/mTOR pathwayNeuronsMultidisciplinarybiologyUbiquitinLysineTOR Serine-Threonine KinasesAutophagyMicrofilament ProteinsUbiquitinationLong-term potentiationBiological SciencesDeubiquitinating Enzyme CYLDMice Inbred C57BLSynapsesbiology.proteinFemaleNeuroscienceSignal TransductionProceedings of the National Academy of Sciences of the United States of America

Presence and biodistribution of perfluorooctanoic acid (PFOA) in Paracentrotus lividus highlight its potential application for environmental biomonit…

2021

AbstractThe first determination of presence and biodistribution of PFOA in ninety specimens of sea urchin Paracentrotus lividus from two differently contaminated sites along Palermo’s coastline (Sicily) is reported. Analyses were performed on the sea urchins’ coelomic fluids, coelomocytes, gonads or mixed organs, as well as on seawater and Posidonia oceanica leaves samples from the collection sites. PFOA concentration ranged between 1 and 13 ng/L in seawater and between 0 and 794 ng/g in P. oceanica. The analyses carried out on individuals of P. lividus from the least polluted site (A) showed PFOA median values equal to 0 in all the matrices (coelomic fluid, coelomocytes and gonads). Conver…

ScienceSettore BIO/05 - ZoologiaBioconcentrationChemicalParacentrotus lividusArticleEnvironmental impactchemistry.chemical_compoundbiology.animalBiomonitoringAnimalsSeawaterTissue DistributionWater PollutantsSea urchinSaline WatersFluorocarbonsMultidisciplinarybiologyEcologyChemistryQRSettore CHIM/06 - Chimica Organicabiology.organism_classificationEnvironmental sciencesEnvironmental chemistryBioaccumulationPosidonia oceanicaEnvironmental chemistryParacentrotusPerfluorooctanoic acidMedicineSeawaterCaprylatesWater Pollutants ChemicalEnvironmental Monitoring

Qué_impide_la_plena_armonía_entre_la_física_y_la_teología_cristiana?

2021

The item is the handout for a seminar session held on 21.09.2021 at the Dpt. of Philosophy of the University of Navarre, Pamplona, Spain. The presentation approaches the question "what is the main reason for the lack of harmony between Physics and Christian theology". This presentation defends the view that the main reason for the lack of harmony is that the epistemological stances are opposed to each other. That opposition can be reduced by developing a conceptual frame that is free of three intrinsic limitations of Physics. This frame is intimately linked to Physics. It does not alter Physics, but gives to Physics an epistemological outlook closer to that of Christian theology, when the l…

BT Doctrinal TheologyQC00 Physics (General)B Philosophy (General)

Gravitational Wave Echo of Relaxion Trapping

2021

To solve the hierarchy problem, the relaxion must remain trapped in the correct minimum, even if the electroweak symmetry is restored after reheating. In this scenario, the relaxion starts rolling again until the backreaction potential, with its set of local minima, reappears. Depending on the time of barrier reappearance, Hubble friction alone may be insufficient to retrap the relaxion in a large portion of the parameter space. Thus, an additional source of friction is required, which might be provided by coupling to a dark photon.The dark photon experiences a tachyonic instability as the relaxion rolls, which slows down the relaxion by backreacting to its motion, and efficiently creates a…

PhysicsCosmology and Nongalactic Astrophysics (astro-ph.CO)Gravitational waveElectroweak interactionDark matterFOS: Physical sciencesHierarchy problemParameter spaceInstabilityDark photonGravitational wave backgroundHigh Energy Physics - PhenomenologyHigh Energy Physics - Phenomenology (hep-ph)Quantum electrodynamicsAstrophysics - Cosmology and Nongalactic Astrophysics

Series of charge transfer complexes obtained as crystals in a confined environment

2021

A series of charge transfer complexes (CTCs) were successfully formed by solvent free processing techniques, using the 1,2,4,5-tetracyano benzene (TCNB) as πA molecule and a series of p-dihydroquinones (H2Qs) as πD counterparts. Additionally to the classical co-evaporation techniques, we obtained CTCs in less than an hour, in a very simple confined environment, between two 100 μm – spaced glass plates. A systematical study by Raman spectroscopy on crystals highlighted the CTCs formation. Moreover, three new crystalline structures were obtained, namely TCNB-H2Q that crystallizes in columns connected to each other by H-bonds, while with the methoxy- and dimethoxy-H2Qs the CTC forms crystals w…

Materials scienceHydrogen bondIntermolecular force02 engineering and technologyGeneral Chemistry010402 general chemistry021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciences0104 chemical scienceschemistry.chemical_compoundsymbols.namesakeCrystallographychemistrysymbols[CHIM]Chemical SciencesMoleculeGeneral Materials ScienceAbsorption (chemistry)van der Waals force0210 nano-technologyBenzeneRaman spectroscopyStoichiometryCrystEngComm

Classification and Automated Interpretation of Spinal Posture Data Using a Pathology-Independent Classifier and Explainable Artificial Intelligence (…

2021

Clinical classification models are mostly pathology-dependent and, thus, are only able to detect pathologies they have been trained for. Research is needed regarding pathology-independent classifiers and their interpretation. Hence, our aim is to develop a pathology-independent classifier that provides prediction probabilities and explanations of the classification decisions. Spinal posture data of healthy subjects and various pathologies (back pain, spinal fusion, osteoarthritis), as well as synthetic data, were used for modeling. A one-class support vector machine was used as a pathology-independent classifier. The outputs were transformed into a probability distribution according to Plat…

Support Vector MachineComputer sciencePostureback painTP1-1185BiochemistryspineSynthetic dataArticlebiomechanicsAnalytical ChemistryMachine LearningClassifier (linguistics)Back painmedicineHumansElectrical and Electronic Engineeringddc:796InstrumentationInterpretation (logic)explainable artificial intelligenceOrientation (computer vision)business.industryChemical technologydata miningartificial intelligenceAtomic and Molecular Physics and OpticsSupport vector machineosteoarthritismachine learningBinary classificationspinal fusionProbability distributionArtificial intelligencemedicine.symptombusinessSensors (Basel, Switzerland)

A long-snouted late Eifelian arthrodire from Aragon (Spain)

2021

Carolowilhelmina geognostica Carls, 1995 is a large arthrodire (Placodermi) from the Tortodus kockelianus Conodont Zone, late Eifelian, in the Eastern Iberian Cordillera in southern Aragon. The somewhat incomplete but articulated skull is preserved, showing a long tubular rostral plate, very small postnasal plates, low toothless inferognathals, and a small, slender and flat parasphenoid. Supraorbital and central sensory lines meet their antimeres at the midline of the skull, forming a straight double line. Lines along the ventral surface of the rostral plate probably belong to the suborbital branches of the infraorbital sensory lines. The combination of characters of Carolowilhelmina points…

biologyParasphenoidPaleontologybiology.organism_classificationQE701-760PaleontologySkullmedicine.anatomical_structurePlacodermimedicinearthrodira long rostrum pelagic environment middle devonian southern aragon spain.EifelianConodontArthrodiraGeologySpanish Journal of Palaeontology

Phenomenological Strands for Gaming Disorder and Esports Play: A Qualitative Registered Report

2021

The recent inclusion of gaming disorder in the ICD-11 as a mental disorder has further increased the importance of researching the health spectrum related to gaming. A critical area in this regard is the lack of clarity concerning the differences between gaming disorder and intensive play, the latter of which often involves several gaming hours per day without related health problems. In this study, we approached the above question by interpretive phenomenological analysis with interviews in two groups of highly involved videogame players: those who seek or have sought clinical help for their problems with gaming (n=6), and those who play esports more than 4 hours per day without self-repor…

riippuvuusvideopelitfenomenologiaongelmapelaaminenterveysaddiktiivisuuspsykopatologia

Has palaeontology answers for some current environmental problems?

2021

History as an irreversible process has no role from a uniformitarian point of view in geology and palaeobiology. Contingency is another trait of history and particle palaeontology has its foundation on such principles. However, new approaches in physics and the theory of systems point out the need to consider a time arrow. Moreover, chance and necessity are interwoven in synergetics and self-organization theory and there may be some possibility of prediction. The global biota has a history resulting from a process of self-organization. A rich fossil record was produced during the Phanerozoic times and this fossil record shows us how life overcame several important crisis. A clear understand…

Extinctionextinction dynamical systems chaos self-organised criticality extinction vulnerability environment gaia hypothesisProcess (engineering)Gaia hypothesisPaleontologyBiotaQE701-760symbols.namesakePaleontologySystems theorysymbolsUniformitarianismContingencySynergetics (Haken)GeologySpanish Journal of Palaeontology

Constant inner potential DFT for modelling electrochemical systems under constant potential and bias

2021

Electrochemical interfaces and reactions play a decisive role in e.g. clean energy conversion but understanding their complex chemistry remains an outstanding challenge. Constant potential or grand canonical ensemble (GCE) simulations are indispensable for unraveling the properties of electrochemical processes as a function of the electrode potential. Currently, constant electrode potential calculations at the density functional theory (DFT) level are carried out by fixing the Fermi level of the simulation cell. However, the Fermi level from DFT calculations does does not always reflect the experimentally controlled electrode potential or describe the thermodynamic independent variable in G…

symbols.namesakeGrand canonical ensembleMaterials scienceChemical physicsFermi levelsymbolsDensity functional theoryConstant (mathematics)ElectrocatalystForce field (chemistry)Electrode potentialElectrochemical potential

Personality Type D, Level of Perceived Stress, Insomnia, and Depression Among High School Teachers in Poland

2021

Teaching is inherently connected with specific burdens that may imply stressful situations. Psychological predispositions of the surveyed group, including personality type D (distressed personality) and level of experienced stress can cause depressive episodes and sleep disorders, which have a direct impact not only on health in terms of disease, but also on well-being and the ability to effectively and properly teach. The research group consisted of 412 high school teachers from the Silesian Province, located in the south of Poland. Using the following research tools: Type D Scale (DS14), Perceived Stress Scale (PSS-10), Athens Insomnia Scale (AIS) and Beck Depression Inventory (BDI), it w…

media_common.quotation_subjectinsomniaPopulationeducationPerceived Stress Scalestressmental disordersInsomniamedicinePersonalityPsychologypersonality type DAthens insomnia scaleeducationGeneral Psychologymedia_commonOriginal Researcheducation.field_of_studyteachersType D personalityBeck Depression InventoryBF1-990depressionmedicine.symptomPsychologyPsychosocialClinical psychologyFrontiers in Psychology

Triple-target stimuli-responsive anti-COVID-19 face mask with physiological virus-inactivating agents

2021

Conventional face masks to prevent SARS-CoV-2 transmission are mostly based on a passive filtration principle. Ideally, anti-COVID-19 masks should protect the carrier not only by size exclusion of virus aerosol particles, but also be able to capture and destroy or inactivate the virus. Here we present the proof-of-concept of a filter mat for such a mask, which actively attracts aerosol droplets and kills the virus. The electrospun mats are made of polycaprolactone (PCL) a hydrophilic, functionalizable and biodegradable polyester, into which inorganic polyphosphate (polyP) a physiological biocompatible, biodegradable and antivirally active polymer (chain length, ∼40 Pi units) has been integr…

Size-exclusion chromatographyBiomedical EngineeringNanoparticle02 engineering and technologyDivalent03 medical and health scienceschemistry.chemical_compoundPolyphosphatesHumansGeneral Materials ScienceIon channel030304 developmental biologychemistry.chemical_classification0303 health sciencesLiposomeCoacervateSARS-CoV-2PolyphosphateMasksCOVID-19021001 nanoscience & nanotechnology3. Good healthChemistrychemistryPolycaprolactoneBiophysicsNanoparticles0210 nano-technology

« Décider avec les sciences » : les auditeurs de l’IHEST visitent CA-SYS. Le 23 septembre dernier, à Bretenière (21), 50 auditeurs de l’Institut des …

2021

National audience; Guidés par Pascal Marget, Pascal Farcy (Unité expérimentale d’Epoisses) et Stéphane Cordeau (chercheur au sein de l’UMR Agréocologie, co-animateur de CA-SYS), ces hauts-cadres du public et du privé, en fonction dans des établissements et des entreprises de l’univers de l’enseignement supérieur et de la recherche, ont pu se rendre compte des enjeux derrière les expérimentations en agroécologie conduites au sein de la plateforme CA-SYS.

[SHS] Humanities and Social Sciences[SHS]Humanities and Social Sciences

A Hybrid Power Supply with Variable Speed Drive for Automatically Move Irrigation Equipment: Margin of Feasibility

2021

Center pivot irrigation systems are widely used in agriculture. Their water pumping systems are primary energy consumers. The use of photovoltaic power plants and variable speed drives of electric motors can reduce energy costs. The purpose of this study is to determine the feasibility of integrating variable speed drives and photovoltaic modules into water pumping systems. A novel architecture of a pumping system was suggested. Its features are no battery backup and the sale of electricity into the grid.

Water pumpingElectric motorPrimary energybusiness.industryComputer sciencePhotovoltaic systemComputerApplications_COMPUTERSINOTHERSYSTEMSAutomotive engineeringCenter pivot irrigationBackupComputerSystemsOrganization_SPECIAL-PURPOSEANDAPPLICATION-BASEDSYSTEMSElectricityHybrid powerbusiness2021 IEEE International Conference on Modern Electrical and Energy Systems (MEES)

Revisión de Douvillininae (Brachiopoda) de la Zona Centroibérica Meridional (Devónico Superior, España)

2021

La subfamilia Douvillininae en el Frasniense de la Zona Centroibérica meridional está representada por el género Douvillina, al que se atribuyen tres especies: Douvillina alvarezi, D. delta y D. radiata. Se propone enmendar la diagnosis del genero Douvillina que aparece en la edición revisada del Treatise on Invertebrate Paleontology (Part H, Brachiopoda), en el sentido de admitir mayor variabilidad en la convexidad de las valvas. Se discute la atribución de D. alvarezi al género así enmendado y se incorporan a la especie ejemplares estratigráficamente más jóvenes que los del material típico.

Paleontologybrachiopoda douvillininae sistemática bioestratigrafia devónico (frasniense) zona centroibérica españa.QE701-760Spanish Journal of Palaeontology

Critical aspects of the physiological interactions between lead and magnesium

2021

Despite technological progress, exposure to lead is an ongoing problem. There are many mechanisms governing the toxic effects of lead on the human body. One such mechanism involves the interaction of this xenobiotic with bivalent metal ions, including magnesium. Literature data suggest that the competition between these elements for binding sites at the molecular and cellular levels, as well as at the systemic level, may represent an important aspect of lead toxicity in the human body. This is especially clear in the context of oxidative stress, immune response, and gene expression modifications. This review aims to summarize current knowledge regarding these issues.

leadMechanism (biology)ChemistryHealth Toxicology and MutagenesisContext (language use)General MedicinemagnesiumToxicologyBiochemistryimmune responseXenobioticschemistry.chemical_compoundLead (geology)Gene Expression Regulationtranscription factorsMolecular MedicineHumansoxidative stressXenobioticMolecular BiologyNeuroscienceJournal of Biochemical and Molecular Toxicology

MIS 5.5 highstand and future sea level flooding at 2100 and 2300 in tectonically stable areas of central mediterranean sea: Sardinia and the pontina …

2021

Areas of the Mediterranean Sea are dynamic habitats in which human activities have been conducted for centuries and which feature micro-tidal environments with about 0.40 m of range. For this reason, human settlements are still concentrated along a narrow coastline strip, where any change in the sea level and coastal dynamics may impact anthropic activities. We analyzed light detection and ranging (LiDAR) and Copernicus Earth observation data. The aim of this research is to provide estimates and detailed maps (in three coastal plain of Sardinia (Italy) and in the Pontina Plain (southern Latium, Italy) of: (i) the past marine transgression occurred during MIS 5.5 highstand 119 kyrss BP

Coastal plainGeography Planning and DevelopmentSubmersion (coastal management)Aquatic ScienceSardiniaBiochemistryMediterranean seaPast (MIS 5.5) and future sea level at 2100 and 2300TD201-500Sea levelWater Science and Technologygeographygeography.geographical_feature_categoryWater supply for domestic and industrial purposesFlooding (psychology)Last Glacial MaximumFuture sea levelHydraulic engineeringCentral Mediterranean coastal plainspast (MIS 5.5) and future sea level at 2100 and 2300 Sardinia Pontina Plain central Mediterranean coastal plainsPhysical geographyTC1-978Central Mediterranean coastal plains; Past (MIS 5.5) and future sea level at 2100 and 2300; Pontina Plain; SardiniaGeologyMarine transgressionPontina Plain

Automated Creation of Expert Systems with the InteKRator Toolbox

2021

Expert systems have a long tradition in both medical informatics and artificial intelligence research. Traditionally, such systems are created by implementing knowledge provided by experts in a system that can be queried for answers. To automatically generate such knowledge directly from data, the lightweight InteKRator toolbox will be introduced here, which combines knowledge representation and machine learning approaches. The learned knowledge is represented in the form of rules with exceptions that can be inspected and that are easily comprehensible. An inference module allows for the efficient answering of queries, while at the same time offering the possibility of providing explanation…

Information retrievalKnowledge representation and reasoningComputer sciencebusiness.industryInferencecomputer.software_genrebusinesscomputerHealth informaticsExpert systemToolbox

false

2021

Background While housing and neighborhood features have the potential to impact opportunities for active aging, there is a lack of knowledge related to how older people reason regarding their housing situation and how housing and fulfillment of relocation are associated with active and healthy aging. Objective The objectives of Prospective RELOC-AGE are to study housing choices and relocation and explore effects on active and healthy aging among men and women aged 55 years and older in Sweden considering relocation. Methods The estimated sample (2800) will include people aged 55 years and older being listed for relocation at either of two housing companies: a local public housing company i…

GerontologyData collectionTelephone interviewAging in placebusiness.industryPublic housingHealth careSample (statistics)General MedicineRelocationbusinessPsychologyGrounded theoryJMIR Research Protocols

Inhibition of autophagy rescues muscle atrophy in a LGMDD2 Drosophila model

2021

Limb-girdle muscular dystrophy D2 (LGMDD2) is an ultrarare autosomal dominant myopathy caused by mutation of the normal stop codon of the TNPO3 nuclear importin. The mutant protein carries a 15 amino acid C-terminal extension associated with pathogenicity. Here we report the first animal model of the disease by expressing the human mutant TNPO3 gene in Drosophila musculature or motor neurons and concomitantly silencing the endogenous expression of the fly protein ortholog. A similar genotype expressing wildtype TNPO3 served as a control. Phenotypes characterization revealed that mutant TNPO3 expression targeted at muscles or motor neurons caused LGMDD2-like phenotypes such as muscle degener…

MaleMutantBiochemistryAnimals Genetically ModifiedMutant proteinAutophagyGeneticsmedicineAnimalsHumansGene silencingMuscular dystrophyMyopathyMolecular BiologyMotor NeuronsbiologyMusclesAutophagyChloroquinebeta Karyopherinsmedicine.diseasebiology.organism_classificationMuscle atrophyCell biologySurvival RateDisease Models AnimalMuscular AtrophyDrosophila melanogasterPhenotypeMuscular Dystrophies Limb-GirdleInsect HormonesFemalemedicine.symptomDrosophila melanogasterLocomotionBiotechnologyThe FASEB Journal

Non-marine invertebrate trace fossils from the Tertiary Calatayud- Teruel Basin, NE Spain. Reply

2021

We thank the comments of Dr Calzada. We think that this kind of discussions is very healthy to the Paleontology and it would be necessary to do it more frequently, so that thanks again for your example. It is true that some of the descriptions of ichnofossils in our work need further discussion and comments, but when we analysed several poorly-preserved specimens (such as the so-called Spongeliomorpha isp.) we preferred to make a quick introduction and describe them in open nomenclature. It was beyond the scope of our paper to make a revision of the ichnogenus with this kind of material, but we hope that Calzada's comments and our reply will improve some ideas concerning the ichnogenus Spon…

GeographyScope (project management)PaleontologyStructural basinTrace fossilArchaeologyOpen nomenclatureQE701-760Spanish Journal of Palaeontology

Estratigrafía y paleontología del yacimiento QUIN-18 (Formación Valmayor, Frasniense, sinclinal de Almaden, España)

2021

n el núcleo del Sinclinal de Almadén (Ciudad Real, España) aflora una potente sucesión vulcano-sedimentaria (Complejo Vulcano-Sedimentario de Chillón), que se apoya sobre una sucesi6n esencialmente limo-pelÍtica (Fm. Yalmayor), ambas frasnienses, en el techo de esta ultima se encontr6 el yacimiento QUIN- I 8, especialmente rico en braquiópodos y ostrácodos fósiles. La edad indicada por estos correspondería a la parte alta de la Zona de Mesotaxis asymmetricus Media hasta la Zona de M. asymmetricus Superior (parte alta de la Zona de Palmatolepis punctata a la Zona de P. hassi Inferior, en la zonación estandar de conodontos).
 Los ostrácodos pertenecen al llamado ecotipo (ökotyp) eifélico…

Paleontologyostracoda brachiopoda bioestratigrafia tafonomía paleoecología frasniense zona centroibérica españa.QE701-760Spanish Journal of Palaeontology

The Palaeontological heritage of Ribeira de Cacela (Algarve, Portugal). Its preservation in the Portuguese context

2021

The protection of palaeontological heritage is justified by its own specificity, which results from its limited visibility, spatial variability, irreproducibility and importance as a record of past biodiversity. Until the present in Portugal the laws concerning the preservation of natural areas are focused mainly on the protection of threatened living species and their habitats, neglecting any geological aspect, and even less the concept of palaeontological heritage. The present analysis refers to the fossil-site of Ribeira de Cacela, included in the Natural Park of Ria Formosa (Algarve, southern Portugal), which represents a site of great paleontological interest. No particular palaeontolo…

GeographyHabitatNOMINATEThreatened specieslanguageBiodiversityNatural monumentPaleontologyContext (language use)PortugueseEnvironmental planninglanguage.human_languageNatural (archaeology)

Paleobiology and paleobiogeography of sclerorhynchid sawfishes (Chondrichthyes, Batomorphii)

2021

Sclerorhynchid sawfishes are a monophyletic group of Cretaceous selachians. They resemble modern sawfishes in the outer morphology and by having a hypertrophic rostral cartilage armed with lateral rows of spines. Generally, sclerorhynchid sawfishes were inhabitants of warm, shallow tropical and subtropical marine environments. Teeth of the oldest sclerorhynchid sawfishes from Spain are presented. They belong to Onchopristis Stromer and come from the lower Barrernian of eastern Spain. The paleobiology and paleogeographic pattern of sclerorhynchid sawfishes is reviewed and discussed.

MonophylyPaleontologybiologyPaleobiologyPaleontologysclerorhynchidae batomorphii paleobiology paleobiogeography.Onchopristisbiology.organism_classificationQE701-760ChondrichthyesCretaceousSpanish Journal of Palaeontology

Metronomic chemotherapy (mCHT) in metastatic triple-negative breast cancer (TNBC) patients: results of the VICTOR-6 study

2021

Abstract Purpose Triple-negative breast cancer (TNBC) represents a subtype of breast cancer which lacks the expression of oestrogen receptor (ER), progesterone receptor (PR) and human epidermal growth factor receptor-2 (HER2): TNBC accounts for approximately 20% of newly diagnosed breast cancers and is associated with younger age at diagnosis, greater recurrence risk and shorter survival time. Therapeutic options are very scarce. Aim of the present analysis is to provide further insights into the clinical activity of metronomic chemotherapy (mCHT), in a real-life setting. Methods We used data included in the VICTOR-6 study for the present analysis. VICTOR-6 is an Italian multicentre retrosp…

OncologyCancer Researchmedicine.medical_specialtyReceptor ErbB-2Breast NeoplasmsTriple Negative Breast NeoplasmsVinorelbineCapecitabine; Cyclophosphamide; Methotrexate; Metronomic chemotherapy; Triple-negative breast cancer; Vinorelbine; Antineoplastic Combined Chemotherapy Protocols; Capecitabine; Cyclophosphamide; Female; Humans; Receptor ErbB-2; Retrospective Studies; Breast Neoplasms; Triple Negative Breast NeoplasmsCapecitabineErbB-2Breast cancerTriple-negative breast cancerRetrospective StudieInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineHumansProgression-free survivalCyclophosphamideTriple-negative breast cancerCapecitabineRetrospective StudiesAntineoplastic Combined Chemotherapy Protocolbusiness.industryMetronomic chemotherapyVinorelbinemedicine.diseaseClinical TrialMetronomic ChemotherapyMetastatic breast cancerRegimenMethotrexateOncologyFemalebusinessBreast NeoplasmHumanReceptormedicine.drug

Una mandibula de Lynx issiodorensis (Croizet y Jobert, 1828) (Carnivora, Mammalia) en el Plioceno Inferior de Cuevas del Almanzora (Almeria, España)

2021

Se describe una mandíbula del felido Lynx issiodorensis (Croizet y Jobert, 1828) hallada en sedimentos marinos del Plioceno inferior (Formación Cuevas), en la localidad de Cuevas del Almanzora (Cuenca de Vera, Almería, España). Se discute su relación con los ejemplares atribuidos a dicha especie, procedentes de diferentes localidades del Plioceno superior y Pleistoceno inferior europeos, y se compara con las formas primitivas de L. issiodorensis del Plioceno inferior español. El rango temporal de la especie en Europa parece cubrir el final del Rusciniense y todo el Villafranquiense. En cambio, en la Península Ibérica abarca todo el Plioceno, pero al parecer es ya sustituida desde el Pleisto…

PaleontologySpanish Journal of Palaeontology

Prevalence of corneal arcus and associated factors in a German population-Results from the Gutenberg Health Study.

2021

Purpose We aimed to determine the prevalence of corneal arcus and to identify associated factors in the general population of Germany. Methods The Gutenberg Health Study (GHS) is a population-based cohort study in Germany, which includes an ophthalmological assessment. Refraction, distance-corrected visual acuity, non-contact tonometry and anterior segment imaging were performed for the five-year follow-up examination. Anterior segment photographs were graded for the presence of corneal arcus. Prevalence estimates were computed, and multivariable logistic regression analysis was applied to determine associated factors for corneal arcus including sex, age, spherical equivalent, central corn…

MaleIntraocular pressureVisual acuitygenetic structuresVisual AcuityBlood PressureCardiovascular MedicineBiochemistryVascular MedicineGeographical locationsCorneaMedical ConditionsEndocrinologyCorneaGermanyMedicine and Health SciencesPrevalenceProspective StudiesDioptreeducation.field_of_studyMultidisciplinaryQRMiddle AgedLipidsEuropemedicine.anatomical_structureCholesterolCardiovascular DiseasesMedicineFemalemedicine.symptomAnatomyCohort studyResearch Articlemedicine.medical_specialtyEndocrine DisordersOcular AnatomySciencePopulationCardiologyArcus SenilisOcular SystemOphthalmologymedicineDiabetes MellitusHumansEuropean UnioneducationIntraocular Pressurebusiness.industryBiology and Life SciencesCardiovascular Disease Riskmedicine.diseaseeye diseasesBlood pressureCross-Sectional StudiesMetabolic DisordersEyessense organsPeople and placesbusinessHeadDyslipidemiaPLoS ONE

Increasing knowledge of odors and molecular structures linkages of smell compounds by comparing UMAP method to other classification approaches

2021

International audience; The olfactory perception begins at the olfactory epithelium level with the activation of olfactory receptors (ORs) by the binding of odorants1. The olfactory system can discriminate a huge number of odors that would reach 1 trillion2. Odor structure relationships in olfaction is a challenging area and a key element in understanding the olfactory system3-5. This study aims to highlight the relationships between the structure of smell compounds and their odors. For this purpose, 6038 odorant compounds and their known associated odors (162 odor notes) were compiled. We assessed four dimensional reduction techniques (PCA, MDS, t-SNE and UMAP6) and two clustering methods …

[SDV.AEN] Life Sciences [q-bio]/Food and Nutrition[SDV.BBM] Life Sciences [q-bio]/Biochemistry Molecular Biology[SDV.BBM]Life Sciences [q-bio]/Biochemistry Molecular Biology[SDV.AEN]Life Sciences [q-bio]/Food and Nutritionpsychological phenomena and processes

Isthmic Spondylolisthesis is Associated with Less Revisions for Adjacent Segment Disease After Lumbar Spine Fusion Than Degenerative Spinal Condition…

2021

Objective: We aim to compare the rate of revisions for adjacent segment disease (ASD) after lumbar spine fusion (LSF) surgery between patients with isthmic spondylolisthesis (IS) and degenerative lumbar spine disorders (DLSD). Summary of Background Data: ASD is a major reason for late reoperations after LSF surgery. Several risk factors are linked to the progression of ASD, but the understanding of the underlying mechanisms is imperfect. If IS infrequently becomes complicated with ASD, it would emphasize the role of the ongoing degenerative process in spine in the development of ASD. Methods: 365 consecutive patients that underwent elective LSF surgery were followed up for an average of 9.7…

medicine.medical_specialtyadjacent segment diseaseLumbar spine fusionspondylolisteesinikamavälilevyn rappeumaIsthmic spondylolisthesisleikkaushoitolannerankaisthmic spondylolisthesisselkäsairaudetdegenerative spinal disordersMedicineOrthopedics and Sports Medicinerevisionsspinal stenosisbusiness.industry10 year follow upadjacent segment pathologydegenerative lumbar spine disordersdegenerative spondylolisthesis3126 Surgery anesthesiology intensive care radiologySurgeryhoitotuloksetNeurology (clinical)Adjacent segment diseaselumbar spine fusionbusiness