0000000000501681

AUTHOR

Sulin Cheng

showing 162 related works from this author

Effects of exercise and diet interventions on obesity-related sleep disorders in men: study protocol for a randomized controlled trial.

2013

Abstract Background Sleep is essential for normal and healthy living. Lack of good quality sleep affects physical, mental and emotional functions. Currently, the treatments of obesity-related sleep disorders focus more on suppressing sleep-related symptoms pharmaceutically and are often accompanied by side effects. Thus, there is urgent need for alternative ways to combat chronic sleep disorders. This study will investigate underlying mechanisms of the effects of exercise and diet intervention on obesity-related sleep disorders, the role of gut microbiota in relation to poor quality of sleep and day-time sleepiness, as well as the levels of hormones responsible for sleep-wake cycle regulati…

MaleLifestyle interventionTime FactorsPsychological interventionMedicine (miscellaneous)Polysomnographyunettomuuslaw.inventionStudy ProtocolRandomized controlled trialClinical ProtocolslawSleep Initiation and Maintenance DisordersSurveys and QuestionnairesInsomniaMedicinePharmacology (medical)FinlandSleep Apnea Obstructivemedicine.diagnostic_testSleep apneaSleep disordersNeurotransmittersMiddle AgedSleep in non-human animalsExercise TherapyIntestinesTreatment OutcomeResearch Designmedicine.symptomInflammation MediatorsSleep measurementAdultmedicine.medical_specialtyInsomniaPolysomnographyGut microbiotaAerobic exerciseHumansObesityunihäiriötAgedbusiness.industrymedicine.diseaseObstructive sleep apneaHormonesDietQuality of sleepObstructive sleep apneaPhysical therapylihavuusbusinessSleepRisk Reduction BehaviorBiomarkersTrials
researchProduct

Long-term leisure time physical activity and properties of bone: A twin study

2009

Effects of physical activity on bone properties, when controlled for genetic effects, are not fully understood. We aimed to study the association between long-term leisure time physical activity (LTPA) and bone properties using twin pairs known to be discordant for leisure time physical activity for at least 30 yr. Volumetric BMD and geometric properties were measured at the tibia shaft and distal end using pQCT in 16 middle-aged (50-74 yr) same-sex twin pairs (seven monozygotic [MZ] and nine dizygotic [DZ] pairs) selected from a population-based cohort. Paired differences between active and inactive co-twins were studied. Active members of MZ twin pairs had larger cortical bone cross-secti…

AdultGerontologymedicine.medical_specialtyHistologyAdolescentBone densityPhysiologyEndocrinology Diabetes and MetabolismOsteoporosisPopulationLong boneLeisure timePhysical activityPhysical exercise030209 endocrinology & metabolismMotor ActivityCohort StudiesYoung Adult03 medical and health sciences0302 clinical medicineBone DensityInternal medicinemedicineHumansOrthopedics and Sports MedicineTibia030212 general & internal medicineeducationAged030304 developmental biology0303 health scienceseducation.field_of_studyTibiabusiness.industryMiddle Agedmedicine.diseaseTwin studyTerm (time)SurgeryCross-Sectional StudiesEndocrinologymedicine.anatomical_structureCortical boneTomography X-Ray ComputedbusinessBone
researchProduct

Effect of time-of-day-specific strength training on serum hormone concentrations and isometric strength in men.

2007

A time-of-day influence on the neuromuscular response to strength training has been previously reported. However, no scientific study has examined the influence of the time of day when strength training is performed on hormonal adaptations. Therefore, the primary purpose of this study was to examine the effects of time-of-day-specific strength training on resting serum concentrations and diurnal patterns of testosterone (T) and cortisol (CORT) as well as maximum isometric strength of knee extensors. Thirty eight diurnally active healthy, previously untrained men (age 20-45 yrs) underwent a ten-week preparatory strength training period when sessions were conducted between 17:00-19:00 h. Ther…

Malemedicine.medical_specialtyHydrocortisoneKnee JointPhysiologyStrength trainingAcclimatizationIsometric exerciseSpecific strengthPhysiology (medical)Internal medicinemedicineHumansTestosteroneCircadian rhythmMuscle StrengthExerciseTestosteroneMorningbusiness.industryDiurnal temperature variationCircadian RhythmEndocrinologyTorquebusinessHormoneChronobiology international
researchProduct

Ventilatory threshold during incremental running can be estimated using EMG shorts

2012

The present study examined whether shorts with textile electromyographic (EMG) electrodes can be used to detect second ventilatory threshold (V(T2)) during incremental treadmill running. Thirteen recreationally active (REC) and eight endurance athletes were measured for EMG, heart rate, blood lactate and respiratory gases during VO(2max) test (3 min ramps, 1 km·h(-1) increments). V(T)(2), onset of blood lactate accumulation (OBLA) and EMG threshold (EMG(T)) were determined. In athletes, OBLA occurred at 56 ± 6 mL·kg(-1)·min(-1), V(T2) occurred at 59 ± 6 mL·kg(-1)·min(-1), and EMG(T) at 62 ± 6 mL·kg(-1)·min(-1) without significant differences between methods (analysis of variance: ANOVA). In…

AdultMalemedicine.medical_specialtyAnaerobic ThresholdPhysiologyLactic acid bloodBiomedical EngineeringBiophysicsRunningTreadmill runningPhysiology (medical)Internal medicineHeart rateBlood lactateHumansMedicineLactic AcidElectromyographybusiness.industryLimits of agreementAthletesPhysical EnduranceCardiologyPhysical therapyPulmonary VentilationVentilatory thresholdbusinessPhysiological Measurement
researchProduct

A randomized controlled trial for response of microbiome network to exercise and diet intervention in patients with nonalcoholic fatty liver disease

2021

AbstractExercise and diet are treatments for nonalcoholic fatty liver disease (NAFLD) and prediabetes, however, how exercise and diet interventions impact gut microbiota in patients is incompletely understood. We previously reported a 8.6-month, four-arm (Aerobic exercise, n = 29; Diet, n = 28; Aerobic exercise + Diet, n = 29; No intervention, n = 29) randomized, singe blinded (for researchers), and controlled intervention in patients with NAFLD and prediabetes to assess the effect of interventions on the primary outcomes of liver fat content and glucose metabolism. Here we report the third primary outcome of the trial—gut microbiota composition—in participants who completed the trial (22 i…

MultidisciplinaryMicrobiotasuolistomikrobistoGeneral Physics and AstronomyGeneral Chemistryinterventiotutkimussatunnaistetut vertailukokeetGeneral Biochemistry Genetics and Molecular BiologyDietPrediabetic StateLiverNon-alcoholic Fatty Liver Diseaseei-alkoholiperäinen rasvamaksasairausHumansExerciseravitsemushoitoliikuntahoito
researchProduct

Association of low 25-hydroxyvitamin D concentrations with elevated parathyroid hormone concentrations and low cortical bone density in early puberta…

2003

Background: Very few studies have evaluated both parathyroid hormone (PTH) and 25-hydroxyvitamin D [25(OH)D] and their effects on bone mass in children. Objective: We studied the associations of serum 25(OH)D and intact PTH (iPTH) with bone mineral content (BMC) and bone mineral density (BMD) at different bone sites and the relation between serum 25(OH)D and iPTH in early pubertal and prepubertal Finnish girls. Design: The subjects were 10‐12-y-old girls (n = 193) at Tanner stage 1 or 2, who reported a mean (± SD) dietary calcium intake of 733 ± 288 mg/d. 25(OH)D, iPTH, tartrate-resistant acid phosphatase 5b (TRAP 5b), urinary calcium excretion, BMC, areal BMD, and volumetric BMD were asses…

musculoskeletal diseasesmedicine.medical_specialtyBone densityAcid PhosphataseMedicine (miscellaneous)Parathyroid hormoneBone resorptionBone DensityInternal medicinemedicineVitamin D and neurologyHumansBone ResorptionVitamin DChildFinlandBone mineralHyperparathyroidismNutrition and DieteticsTartrate-Resistant Acid PhosphataseChemistryPubertyVitamin D Deficiencymedicine.diseaseUrinary calciumCalcium DietaryIsoenzymesCross-Sectional StudiesEndocrinologyParathyroid HormoneCalciumFemaleHyperparathyroidism SecondarySecondary hyperparathyroidismSeasonsBiomarkersThe American Journal of Clinical Nutrition
researchProduct

Effects of exercise and dietary interventions on serum metabolites in men with insomnia symptoms: A 6-month randomized controlled trial

2020

Abstract Accumulating evidence show that exercise and diet interventions are associated with improved sleep quality. Studies investigating the effects of exercise and dieting on circulating metabolomics in people with sleep disorders, particularly insomnia, are scarce. This 6-month randomized study aimed to assess the effects of exercise and dietary interventions on serum metabolites in men with insomnia symptoms. Seventy-two Finnish men (age: 51.6 ± 10.1 years) with chronic insomnia symptoms who were assigned to different intervention groups completed this study (exercise, n = 24; diet, n = 27; and control, n = 21). The Shapiro-Wilk W-test, Levene test, Spearman correlation analysis, and a…

lcsh:R5-920medicine.medical_specialtyInsomniabusiness.industryPsychological interventionPhysical Therapy Sports Therapy and RehabilitationSleep in non-human animalsDietlaw.inventionDietary interventionsRandomized controlled triallawIntervention (counseling)InsomniamedicinePhysical therapyMetabolomicsOrthopedics and Sports MedicineAnalysis of variancemedicine.symptomlcsh:Medicine (General)businessExerciseDietingSports Medicine and Health Science
researchProduct

Serum TRACP 5b Is a Useful Marker for Monitoring Alendronate Treatment: Comparison With Other Markers of Bone Turnover

2005

We studied clinical performance of serum TRACP 5b and other bone turnover markers, including S-CTX, U-DPD, S-PINP, S-BALP, and S-OC, for monitoring alendronate treatment. TRACP 5b had higher clinical sensitivity, area under the ROC curve, and signal-to-noise ratio than the other markers. INTRODUCTION: The purpose of this study was to compare the clinical performance of serum TRACP 5b (S-TRACP5b) with that of other markers of bone turnover in the monitoring of alendronate treatment. MATERIALS AND METHODS: This double-blinded study included 148 healthy postmenopausal women that were randomly assigned into two groups: one receiving 5 mg alendronate daily (n=75) and the other receiving placebo …

medicine.medical_specialtyDeoxypyridinolineEndocrinology Diabetes and MetabolismAcid PhosphataseUrologyPlaceboBone resorptionBone remodelingchemistry.chemical_compoundDouble-Blind MethodOsteogenesisInternal medicinemedicineVitamin D and neurologyHumansOrthopedics and Sports MedicineVitamin DAlendronateBone Density Conservation AgentsReceiver operating characteristicbiologyTartrate-Resistant Acid Phosphatasebusiness.industryAlendronic acidMiddle AgedIsoenzymesPostmenopauseEndocrinologychemistryOsteocalcinbiology.proteinCalciumFemaleDrug MonitoringbusinessBiomarkersmedicine.drugJournal of Bone and Mineral Research
researchProduct

Effects of a low-frequency sound wave therapy programme on functional capacity, blood circulation and bone metabolism in frail old men and women

2009

Objective: To evaluate the effects of a low-frequency sound wave therapy programme on functional capacity, blood circulation and bone metabolism of the frail elderly. Design: Single-blind, randomized, controlled trial. Setting: Two senior service centres. Subjects: Forty-nine volunteers (14 males and 35 females) aged 62—93 years with up to 12 diagnosed diseases were allocated in either the intervention group (n = 30) or control group (n = 19). Intervention: The intervention group underwent sound wave therapy, 3—5 times a week for 30 minutes per session over a period of 6 months. The control group received no intervention. Main measurements: Blood pressure, functional capacity, mobility, bo…

Complementary TherapiesMalemedicine.medical_specialtyBone densityFrail ElderlyAcid PhosphataseOsteocalcinPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseVibrationlaw.inventionBone remodelingRandomized controlled trialBone DensitylawKilometerIntervention (counseling)HumansMedicineSingle-Blind MethodMuscle StrengthAgedBalance (ability)Aged 80 and overTartrate-Resistant Acid Phosphatasebusiness.industryRehabilitationCholesterol LDLMiddle AgedIsoenzymesBlood pressureBlood CirculationPhysical EndurancePhysical therapyFemalebusinessClinical Rehabilitation
researchProduct

Ion-sputtering deposition of Ca–P–O films for microscopic imaging of osteoblast cells

2007

Abstract An ion-beam sputtering technique was used to produce Ca–P–O films on borosilicate glass at room temperature from hydroxyapatite targets using nitrogen, argon and krypton beams at different acceleration voltages. The sputtering target was pressed from high purity hydroxyapatite powder or mixture of high purity hydroxyapatite powder and red phosphorus in order to optimise the film composition. The film composition, determined using time-of-flight elastic recoil detection analysis (TOF–ERDA), was found to be strongly dependent on the ion energy used for deposition. By extra doping of the target with P the correct Ca/P atomic ratio in the deposited films was reached. The films deposite…

Nuclear and High Energy PhysicsIon beam analysisArgonMaterials scienceAnnealing (metallurgy)Borosilicate glassAnalytical chemistrychemistry.chemical_elementAmorphous solidElastic recoil detectionchemistrySputteringAtomic ratioInstrumentationNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Growth patterns at distal radius and tibial shaft in pubertal girls: a 2-year longitudinal study.

2005

Bone changes, in terms of both size and BMD, were assessed longitudinally in pubertal girls. Before puberty, BMD at the distal radius declined, whereas bone size increased, suggesting that normal growing girls experience a transient period of increased bone fragility. This could explain the elevated low-trauma forearm fracture rates reported in earlier studies. Introduction: Longitudinal data on bone growth during puberty are sparse. Such information is needed to understand the sequence of biological changes, the physical and mechanical consequences for the growing skeleton, and the implications for later life. Materials and Methods: The geometric properties and volumetric BMD (vBMD) of the…

Time FactorsBone densityAdolescentEndocrinology Diabetes and Metabolismmedicine.medical_treatmentBone and BonesBone DensityMedicineHumansOrthopedics and Sports MedicineTibiaLongitudinal StudiesChildReduction (orthopedic surgery)Bone growthMenarcheBone DevelopmentModels StatisticalAnthropometryTibiabusiness.industryBody WeightPubertyAnatomySkeleton (computer programming)Body HeightAppositionRadiusMenarcheLinear ModelsFemalebusinessDensitometryDensitometryJournal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research
researchProduct

The effects of muscle mass and muscle quality on cardio-metabolic risk in peripubertal girls: a longitudinal study from childhood to early adulthood.

2017

Increased cardio-metabolic risk is well documented in children and adolescents with obesity and normal weight obesity (NWO). However, the associations of muscle mass and muscle quality with cardio-metabolic risk, independent of weight status from childhood to adulthood, has not been examined. A total of 236 girls were followed from pre-puberty to early adulthood. Fat mass (FM) and lean mass (LM) of the whole body were assessed by a dual-energy X-ray absorptiometry; muscle cross-sectional area (mCSA), muscle density (mDen; skeletal muscle fat content) of the lower leg by the peripheral quantitative computerized tomography; and blood glucose, insulin, triglycerides and high-density lipoprotei…

Endocrinology Diabetes and Metabolismmedicine.medical_treatmentlongitudinal researchMedicine (miscellaneous)030204 cardiovascular system & hematologyOverweightBody Mass Index0302 clinical medicineRisk FactorsLongitudinal StudiesChildrasva-arvotNutrition and DieteticsFramingham Risk Scoregirlsta3141tytötNormal weight obesitymedicine.anatomical_structuremuscle massAdipose TissueCardiovascular DiseasesFemalemedicine.symptommedicine.medical_specialtyAdolescentblood sugar030209 endocrinology & metabolismpitkittäistutkimus03 medical and health sciencesInternal medicinemedicinefatty acid levelsHumansObesityMuscle Skeletalkehonkoostumusbody compositionbusiness.industryInsulinSkeletal muscleOverweightmedicine.diseaseObesityEndocrinologylihasmassaverensokeriLean body massbusinessBody mass indexInternational journal of obesity (2005)
researchProduct

Assessment of the cortical bone thickness using ultrasonic guided waves: Modelling and in vitro study

2007

Determination of cortical bone thickness is warranted, e.g., for assessing the level of endosteal resorption in osteoporosis or other bone pathologies. We have shown previously that the velocity of the fundamental antisymmetric (or flexural) guided wave, measured for bone phantoms and bones in vitro, correlates with the cortical thickness significantly better than those by other axial ultrasound methods. In addition, we have introduced an inversion scheme based on guided wave theory, group velocity filtering and 2-D fast Fourier transform, for determination of cortical thickness from the measured velocity of guided waves. In this study, the method was validated for tubular structures by usi…

Materials scienceAcoustics and UltrasonicsBiophysicsModels BiologicalRadius boneOpticsBone DensitymedicineHumansUltrasonicsRadiology Nuclear Medicine and imagingQuantitative computed tomographyPolyvinyl ChlorideUltrasonographyGuided wave testingRadiological and Ultrasound Technologymedicine.diagnostic_testPhantoms Imagingbusiness.industryUltrasoundReproducibility of ResultsRadiusmedicine.anatomical_structurePlate theoryCortical boneUltrasonic sensorTomographyTomography X-Ray ComputedbusinessBiomedical engineeringUltrasound in Medicine & Biology
researchProduct

Maximal isometric strength indices are associated with the oxygen cost of walking and running in recreationally active men and women.

2021

This study assessed the associations of maximal isometric strength and movement economy in 126 recreationally active men and women. Oxygen consumption was assessed through a graded treadmill test with 4-minute increments (4-12 km∙h

Malemedicine.medical_specialtyHand Strengthbusiness.industrychemistry.chemical_elementPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseWalkingOxygenRunningOxygenPhysical medicine and rehabilitationOxygen ConsumptionchemistryMaximal strengthMedicineHumansOrthopedics and Sports MedicineFemaleMuscle StrengthTreadmillbusinessMuscle SkeletalResearch in sports medicine (Print)
researchProduct

Modeling the impact of soft tissue on axial transmission measurements of ultrasonic guided waves in human radius

2008

Recent in vitro and simulation studies have shown that guided waves measured at low ultrasound frequencies (f=200 kHz) can characterize both material properties and geometry of the cortical bone wall. In particular, a method for an accurate cortical thickness estimation from ultrasound velocity data has been presented. The clinical application remains, however, a challenge as the impact of a layer of soft tissue on top of the bone is not yet well established, and this layer is expected to affect the dispersion and relative intensities of guided modes. The present study is focused on the theoretical modeling of the impact of an overlying soft tissue. A semianalytical method and finite-differ…

AdultMaleTime FactorsMaterials scienceAcoustics and UltrasonicsAcousticsModels BiologicalMotionYoung AdultOpticsArts and Humanities (miscellaneous)Image Interpretation Computer-AssistedmedicineHumansComputer SimulationTime domainDispersion (water waves)AgedUltrasonographyAged 80 and overGuided wave testingbusiness.industryUltrasoundBiomechanicsReproducibility of ResultsNumerical Analysis Computer-AssistedRadiusMiddle AgedRadiusmedicine.anatomical_structureConnective TissueFemaleUltrasonic sensorCortical bonebusinessThe Journal of the Acoustical Society of America
researchProduct

VALIDITY, RELIABILITY AND FEASIBILITY OF MEASURING MUSCLE ACTIVITY WITH TEXTILE ELECTRODES EMBEDDED INTO CLOTHING

2007

INTRODUCTION In out-of-laboratory settings the surface EMG measurements are complicated by the requirement of careful electrode placement and skin preparation. The development of washable textile electrodes that can be sowed into sportswear enable muscle activity recordings during normal locomotion without skin preparation and the problem of wires hanging around the body [1]. In this study we performed validity, reliability and feasibility tests of the textile electrodes embedded into shorts against the traditional bipolar surface electrodes.

Engineering drawingMaterials sciencebusiness.industryRehabilitationBiomedical EngineeringBiophysicsfood and beveragesClothingValidity reliabilityOrthopedics and Sports MedicineMuscle activitybusinessElectrode placementTextile electrodesReliability (statistics)Biomedical engineeringSkin preparationJournal of Biomechanics
researchProduct

Trait-specific tracking and determinants of body composition: a 7-year follow-up study of pubertal growth in girls

2008

Abstract Background Understanding how bone (BM), lean (LM) and fat mass (FM) develop through childhood, puberty and adolescence is vital since it holds key information regarding current and future health. Our study aimed to determine how BM, LM and FM track from prepuberty to early adulthood in girls and what factors are associated with intra- and inter-individual variation in these three tissues. Methods The study was a 7-year longitudinal cohort study. BM, LM and FM measured using dual-energy X-ray absorptiometry, self-reported dietary information, leisure time physical activity (LTPA) and other factors were assessed one to eight times in 396 girls aged 10 to 13 years (baseline), and in 2…

AdultPercentilemedicine.medical_specialtyBone densityAdolescentPhysiologyMotherslcsh:MedicineMotor ActivityDiet SurveysCohort StudiesAbsorptiometry PhotonBone DensityPrepubertyInternal medicinemedicineHumansParent-Child RelationsChildMedicine(all)business.industrySiblingsBody WeightPubertylcsh:RGeneral MedicineHeritabilityMiddle AgedPedigreeEndocrinologyQuartileLean body massFemalebusinessBreast feedingCohort studyFollow-Up StudiesResearch ArticleBMC Medicine
researchProduct

Guided ultrasonic waves in long bones: modelling, experiment and in vivo application.

2002

Existing ultrasound devices for assessing the human tibia are based on detecting the first arriving signal, corresponding to a wave propagating at, or close to, the bulk longitudinal velocity in bone. However, human long bones are effectively irregular hollow tubes and should theoretically support the propagation of more complex guided modes similar to Lamb waves in plates. Guided waves are attractive because they propagate throughout the bone thickness and can potentially yield more information on bone material properties and architecture. In this study, Lamb wave theory and numerical simulations of wave propagation were used to gain insights into the expected behaviour of guided waves in …

PhysiologyWave propagationAcousticsPhysics::Medical PhysicsBiomedical EngineeringBiophysicsAcrylic ResinsSignalModels BiologicalLamb wavesOpticsPhysiology (medical)HumansComputer SimulationUltrasonographyPhysicsGuided wave testingTibiabusiness.industryPhantoms ImagingSurface waveOsteoporosisUltrasonic sensorbusinessMechanical waveLongitudinal wavePhysiological measurement
researchProduct

Serum osteocalcin is not associated with glucose but is inversely associated with leptin across generations of nondiabetic women.

2012

The skeleton is recognized as an important player in energy metabolism through its interactions with other tissues. Whether the association of osteocalcin with glucose metabolism is age dependent has not been fully addressed.The objective of the study was to examine the age-specific association between different forms of osteocalcin and glucose and adipokines.This was a family-based study across three generations.The study was conducted at a university laboratory.Sixty-four daughter-premenopausal mother-maternal grandmother trios participated in the study.Fasting plasma glucose and insulin concentrations, serum total (tOC), carboxylated (cOC), and uncarboxylated (ucOC = tOC - cOC) osteocalc…

AdultBlood GlucoseLeptinmedicine.medical_specialtyAdolescentEndocrinology Diabetes and Metabolismmedicine.medical_treatmentClinical BiochemistryOsteocalcinAdipokineContext (language use)Carbohydrate metabolismBiochemistryBone and BonesEndocrinologyInsulin resistanceInternal medicinemedicineHumansInsulinAgedbiologyAdiponectinLeptinInsulinBiochemistry (medical)Age FactorsMiddle Agedmedicine.diseaseEndocrinologyPremenopauseOsteocalcinbiology.proteinFemaleAdiponectinInsulin ResistanceThe Journal of clinical endocrinology and metabolism
researchProduct

Estimation of structural and geometrical properties of cortical bone by computerized tomography in 78-year-old women

2009

The structural and geometrical properties of the tibia shaft were investigated at two sections by means of computerized tomography (CT) in 78-year-old women with high (n = 19) and low (n = 17) calcaneal bone mineral density (BMD, g/cm3) previously measured by 125I-photon absorption. The high BMD group had a 20-21% higher tibial BMD and 9-12% higher bone cross-sectional area than was observed in the low BMD group. The distribution of bone mass indicated that the low BMD group had lost bone mainly from the endosteal surface, especially in the anterior part of the tibia. However, both groups had a similar basic pattern of mass distribution at the measured sections. The high BMD group had highe…

musculoskeletal diseasesBone densityEndocrinology Diabetes and MetabolismBody Mass IndexFractures BoneAbsorptiometry PhotonBone DensityRisk FactorsmedicineAnimalsHumansOrthopedics and Sports MedicineTibiaAgedBone mineralOrthodonticsTibiaBody WeightBiomechanicsAnatomymusculoskeletal systemBiomechanical PhenomenaCalcaneusmedicine.anatomical_structureCattleFemaleCortical boneTomographyCalcaneusBody mass indexMathematicsTomography Emission-ComputedJournal of Bone and Mineral Research
researchProduct

Wettability and compositional analysis of hydroxyapatite films modified by low and high energy ion irradiation

2008

Abstract Hydroxyapatite-like thin films on silicon substrate were deposited using atomic layer deposition and were subjected to irradiation with Ar ions accelerated through 0.6–1.2 kV as well as 2 MeV 16 O + ions. After low energy Ar irradiation a significant reduction in contact angle was observed. However, the Ca/P atomic ratio remained unchanged. No reduction in contact angle was seen for high energy 16 O + irradiation. Atomic force microscopy showed the enhancement of floral-like pattern after low energy Ar bombardment while high energy oxygen irradiation lead to raised islands on as-deposited films.

Nuclear and High Energy PhysicsMaterials scienceSiliconAnalytical chemistrychemistry.chemical_elementSubstrate (electronics)IonContact angleAtomic layer depositionchemistryAtomic ratioIrradiationThin filmInstrumentationNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

84 Enhanced Characterization of the Thickness and Bone Mineral Density of the Radius and Tibia by Low-Frequency Guided-Wave Ultrasound

2009

Bone mineralGuided wave testingbusiness.industryEndocrinology Diabetes and MetabolismUltrasoundRadiusLow frequencyCharacterization (materials science)MedicineRadiology Nuclear Medicine and imagingOrthopedics and Sports MedicineTibiabusinessBiomedical engineeringJournal of Clinical Densitometry
researchProduct

Estrogen receptor alpha polymorphism modifies the association between childhood exercise and bone mass: follow-up study.

2007

This follow-up study confirms our previous findings that the ER-α PvuII polymorphism (Pp) modulates the association between exercise and bone mass. The differences in bone properties of girls with consistently low physical activity (LLPA) and consistently high physical activity (HHPA) were evident only in those bearing the heterozygote ER-α genotype (Pp). In particular, areal bone mineral density of the total femur, bone mineral content and areal bone mineral density of the femoral neck, and bone mineral content and cortical thickness of the tibia shaft were significantly (p < .05) lower in the Pp girls with LLPA than in their HHPA counterparts. These findings might partly explain the ge…

medicine.medical_specialtyHeterozygoteBone densityGenotypePhysical Therapy Sports Therapy and RehabilitationCohort StudiesAbsorptiometry PhotonBone DensityInternal medicineGenotypemedicineHumansOrthopedics and Sports MedicineFemurChildExerciseFemoral neckBone mineralBone DevelopmentPolymorphism Geneticbusiness.industryEstrogen Receptor alphaHeterozygote advantagemedicine.anatomical_structureEndocrinologyPediatrics Perinatology and Child HealthLinear ModelsFemalebusinessEstrogen receptor alphaBone massFollow-Up StudiesPediatric exercise science
researchProduct

Assessment of the tibia using ultrasonic guided waves in pubertal girls

2002

The purpose of this study was to compare low frequency ultrasonic guided wave measurements with established ultrasound and bone density measurements in terms of their ability to characterize the tibia in pubertal girls. Subjects were 12-14-year-old girls ( n=106) who were participating in a calcium and vitamin D intervention study. A prototype low frequency pulse transmission device consisting of a uniaxial scanning mechanism and low frequency transducers orientated perpendicularly to the limb was used to measure two ultrasound velocities in the tibia. The first velocity, V1, was that of the first arriving signal, similar to that measured by existing commercial tibial ultrasound devices. Th…

musculoskeletal diseasesAdolescentBone densityEndocrinology Diabetes and MetabolismOsteoporosisBone DensitymedicineHumansUltrasonicsTibiaChildGuided wave testingTibiabusiness.industryBody WeightPubertyUltrasoundAnatomymusculoskeletal systemmedicine.diseaseBody HeightCalcaneusRadiusmedicine.anatomical_structureRegression AnalysisFemaleCortical boneUltrasonic sensorCalcaneusTomography X-Ray ComputedbusinessBiomedical engineeringOsteoporosis International
researchProduct

The Association between Cardiorespiratory Fitness and Gut Microbiota Composition in Premenopausal Women

2017

Abstract The aim of this study was to investigate the association between cardiorespiratory fitness and gut microbiota composition in premenopausal women. The participants consisted of 71 premenopausal Finnish women (aged 19–49 years). Gut microbiota were analyzed using flow cytometry, 16S rRNA gene hybridization and DNA-staining. Maximum oxygen uptake (VO₂ₘₐₓ) was assessed by respiratory gas analyzer and body composition by Bioimpdance. We found that participants with low VO₂ₘₐₓ had lower Bacteroides, but higher Eubacterium rectale-Clostridium coccoides than the high VO₂ₘₐₓ group (p < 0.05 for all). VO₂ₘₐₓ was inversely associated with EreC (r = −0.309, p = 0.01) but not with other bact…

Leptin0301 basic medicineGut floraFeces0302 clinical medicineRNA Ribosomal 16SBacteroidesta318EubacteriumFinlandexercise; VO<sub>2max</sub>; gut microbiota; body fatnessNutrition and DieteticsexercisebiologyLeptinVO2 maxta3141Middle Agedfyysinen kuntoCholesterolCardiorespiratory FitnessBody CompositionFemaleDietary Proteinslcsh:Nutrition. Foods and food supplyAdultDNA Bacterialmedicine.medical_specialtylcsh:TX341-641030209 endocrinology & metabolismArticleWhite PeopleYoung Adult03 medical and health sciencesOxygen ConsumptionInternal medicinemaksimaalinen hapenottoDietary CarbohydratesmedicineHumansTriglycerideskehonkoostumusClostridiumgut microbiotaEubacteriumCardiorespiratory fitnessSequence Analysis DNACarbohydratebiology.organism_classificationDietary FatsVO₂ₘₐₓGastrointestinal MicrobiomemikrobistoCross-Sectional Studies030104 developmental biologyEndocrinologysuolistoPremenopausePhysical Fitnessbody fatnessBacteroidesVO2maxRespiratory gas analyzerFood ScienceNutrients
researchProduct

Thigh muscle function in stroke patients revealed by velocity-encoded cine phase-contrast magnetic resonance imaging.

2008

Current methods of clinical assessment of muscle coordination and function after stroke do not provide information on deep muscles. The objective of this study was to examine how stroke affects both superficial and deep muscles' coordination and whether muscle function improves after rehabilitation. Muscle function, coordination, and activity of quadriceps femoris (QF) and hamstrings were evaluated in 10 stroke patients with mild hemiparesis and in 6 controls using velocity-encoded cine phase-contrast magnetic resonance imaging (VE-PC MRI), surface electromyography (sEMG), and maximal voluntary isometric contraction torque (MVC). At baseline, the peak muscle velocity of the rectus femoris (…

Malemedicine.medical_specialtyPhysiologyMagnetic Resonance Imaging CineIsometric exerciseElectromyographyRectus femoris muscleTendonsCellular and Molecular NeurosciencePhysiology (medical)Internal medicinemedicineHumansMuscle StrengthMuscle SkeletalStrokeAgedmedicine.diagnostic_testbusiness.industryElectromyographyStroke RehabilitationMagnetic resonance imagingAnatomyMiddle Agedmedicine.diseaseMotor coordinationParesisStrokeHemiparesisThighData Interpretation StatisticalCardiologyFemaleNeurology (clinical)medicine.symptombusinessMuscle contractionMuscle ContractionMusclenerve
researchProduct

Does Serum 25-Hydroxyvitamin D Influence Muscle Development during Puberty in Girls? - A 7-Year Longitudinal Study

2013

Vitamin D is well known for its regulatory role in calcium and phosphate homeostasis, but its role in muscle mass and strength during growth remains inconclusive. We explored the association of serum 25-hydroxyvitamin D (25(OH)D) with muscle development in girls from 11 to 18-years old. Whole body lean tissue mass (LMWB), appendicular lean mass (aLM), muscle cross-sectional area at the lower leg (mCSA), maximal voluntary contraction of elbow flexors (MVC elbow) and knee extensors (MVC knee) were assessed in 217 girls aged 10-13 years (at baseline), 215 in 2-year and 226 in 7.5-year follow-up. Serum concentration of 25(OH)D and intact parathyroid hormone (PTH) were analyzed retrospectively a…

medicine.medical_specialtyLongitudinal studyAdolescentlcsh:MedicineParathyroid hormone25-Hydroxyvitamin DMuscle DevelopmentPolymorphism Single NucleotideCalcitriol receptorvitamin D deficiencyInternal medicinemedicineVitamin D and neurologyHumansLongitudinal StudiesMuscle StrengthVitamin Dlcsh:ScienceChildMultidisciplinarybusiness.industrylcsh:RPubertyConfoundinglongitudinal studyta3141murrosikäVitamin D Deficiencymedicine.diseaseEndocrinologyParathyroid HormoneBody CompositionLean body massMenarcheReceptors Calcitriolmuscle developmentlcsh:QCalciumFemalebusinessResearch ArticlePLoS ONE
researchProduct

Ultrasonic guided wave propagation in long bones with varying cortical thickness

2009

The propagation of ultrasonic guided wave (GW) in the long bone is very sensitive to the bones' shapes, properties and cortical thicknesses (CTh). Most of the previous studies on the GW propagation in long bones mainly focused on the bones with uniform CTh. However, it is necessary to understand the impacts of CTh variation, such as mode conversion. Therefore, an adequate analysis on GW propagating in long bones with varying CTh is essential for the precise calibration of the quantitative measurement of it. The aim of this study is to use a modified boundary element method (BEM) to analyze the GW propagation characteristics in long bones with varying CTh. Numerical analysis implemented by t…

Ultrasonic guided waveOpticsMaterials sciencebusiness.industryBioacousticsAcousticsNumerical analysisCalibrationSensitivity (control systems)Transmission coefficientbusinessBoundary element methodCutoff frequency2009 IEEE International Ultrasonics Symposium
researchProduct

Towards early risk biomarkers: serum metabolic signature in childhood predicts cardio-metabolic risk in adulthood

2021

Summary: Background: Cardiovascular diseases may originate in childhood. Biomarkers identifying individuals with increased risk for disease are needed to support early detection and to optimise prevention strategies. Methods: In this prospective study, by applying a machine learning to high throughput NMR-based metabolomics data, we identified circulating childhood metabolic predictors of adult cardiovascular disease risk (MetS score) in a cohort of 396 females, followed from childhood (mean age 11·2 years) to early adulthood (mean age 18·1 years). The results obtained from the discovery cohort were validated in a large longitudinal birth cohort of females and males followed from puberty to…

MaleGerontologyMedicine (General)Longitudinal studyApolipoprotein BbiomarkkeritDiseaseType 2 diabetesRisk FactorsInformed consentProspective StudiesChildProspective cohort studyFinlandmedia_commonFramingham Risk ScorebiologyRriskitekijätGeneral MedicineALSPACmetabolomicsaikuisuusCardiovascular DiseasesCohortMedicineBirth CohortFemaleResearch Papermedicine.medical_specialtyAdolescentlongitudinal-studypitkittäistutkimusGeneral Biochemistry Genetics and Molecular BiologyR5-920childrencardio-metabolic riskInternal medicinemedicineHumansmedia_common.cataloged_instanceEuropean unionApolipoproteins AApolipoproteins Bbusiness.industryPubertyCardio metabolic risklapsuusmedicine.diseaseCross-Sectional StudiesDiabetes Mellitus Type 2biology.proteinsydän- ja verisuonitauditaineenvaihduntatuotteetbusinessBiomarkersDeclaration of HelsinkieBioMedicine
researchProduct

The Effect of a Ketogenic Low-Carbohydrate, High-Fat Diet on Aerobic Capacity and Exercise Performance in Endurance Athletes: A Systematic Review and…

2021

A low-carbohydrate, high-fat (LCHF) diet has been proposed to enhance the fat utilization of muscle and the aerobic capacity of endurance athletes, thereby improving their exercise performance. However, it remains uncertain how the macronutrient intake shift from carbohydrate to fat affects endurance exercise training and performance. This study performed a systematic review and meta-analysis to explore the effects of a ketogenic low-carbohydrate, high-fat (K-LCHF) diet on aerobic capacity and exercise performance among endurance athletes. Searches were carried out in five electronic databases, and we followed the Preferred Reporting Items for Systematic Review and Meta-Analyses (PRISMA) gu…

AdultMalemedicine.medical_specialtyReviewYoung AdultOxygen ConsumptionEndurance trainingkestävyyslajitLow carbohydrate high fatExercise performancemedicineHumansTX341-641Aerobic capacitysystemaattiset kirjallisuuskatsauksetRating of perceived exertionNutrition and DieteticsExercise Tolerancebiologybusiness.industryAthletesNutrition. Foods and food supplymeta-analyysiHemodynamicsVO2 maxendurance athletesMiddle Agedbiology.organism_classificationketogeeninen ruokavalioaerobic capacityhigh-fat dietAthletesMeta-analysisPhysical therapyPhysical EnduranceRespiratory MechanicsFemaleaerobinen suorituskykybusinessDiet KetogenicNutritive Valueketogenic low-carbohydrateFood SciencePhysical Conditioning HumanNutrients
researchProduct

Calcaneal Bone Mineral Density Predicts Fracture Occurrence: A Five-Year Follow-up Study in Elderly People

1997

A 5-year follow-up study investigated calcaneal bone mineral density (BMD) and changes in BMD in relation to fracture occurrence. The subjects comprised two cohorts born in 1914 and 1910 living in the city of Jyväskylä in central Finland. One hundred and three men (82%) and 188 women (73%), aged 75, and 57 men (74%) and 136 women (65%), aged 80, of the eligible population participated in the baseline bone measurements. The follow-up bone measurements were obtained for 59 men (68%) and 119 women (66%), aged 80 years, and for 21 men (53%) and 61 women (48%), aged 85 years. During the follow-up period, 8 men and 36 women from the younger and 11 men and 24 women from the older cohort sustained …

Malemusculoskeletal diseasesmedicine.medical_specialtyEndocrinology Diabetes and MetabolismPopulationBone MeasurementsCohort StudiesFractures BoneBone DensityRisk FactorsmedicineHumansElderly peopleOrthopedics and Sports MedicineeducationFinlandAgedProbabilityProportional Hazards ModelsAged 80 and overBone mineraleducation.field_of_studybusiness.industryFive year follow upSurgeryCalcaneusCohortFemaleCalcaneusbusinessFollow-Up StudiesDemographyBone massJournal of Bone and Mineral Research
researchProduct

PO-279 Bidirectional Associations Between Physical Activity and Adiposity From Childhood to Early Adulthood

2018

Objective Inverse association between physical activity and adiposity in children and adolescents have been documented in numerous studies. However, few studies have examined the direction of causation between these two variables. We aimed to examine the prospective bidirectional associations between physical activity and adiposity from childhood to early adulthood.&#x0D; Methods A total of 396 girls (mean age, 11.2 years at baseline) participated in a longitudinal study with 1, 2, 4, and 7 year follow-ups. Body height and weight were measured, body composition was assessed by DXA and BMI and fat mass index (FMI) were calculated. Leisure-time physical activity (LTPA) and physical inactivity…

Longitudinal studyLeast significant differencebusiness.industryPost-hoc analysisEarly adulthoodPhysical activityMedicineAnalysis of variancebusinessmedicine.diseaseObesityPhysical activity levelDemographyExercise Biochemistry Review
researchProduct

Recommendations for Determining the Validity of Consumer Wearables and Smartphones for the Estimation of Energy Expenditure : Expert Statement and Ch…

2022

Open Access funding provided by the IReL Consortium. This research was partly funded by Huawei Technologies, Finland. RA and BC are partly funded by Science Foundation Ireland (12/RC/2289_P2). PMG and FBO are supported by grants from the MINECO/FEDER (DEP2016-79512-R) and from the University of Granada, Plan Propio de Investigacion 2016, Excellence actions: Units of Excellence; Scientific Excellence Unit on Exercise and Health (UCEES); Junta de Andalucia, Consejeria de Conocimiento, Investigacion y Universidades and European Regional Development Funds (ref. SOMM17/6107/UGR). JT and JS are partly funded by the Research Council of Norway (249932/F20). AG is supported by a European Research Co…

mittaustekniikkahyvinvointiteknologiavaliditeettiPhysical Therapy Sports Therapy and RehabilitationOrthopedics and Sports Medicinepuettava teknologiafyysinen aktiivisuusenergiankulutus (aineenvaihdunta)systemaattiset kirjallisuuskatsauksetälypuhelimet
researchProduct

Assessing body composition with DXA and bioimpedance: effects of obesity, physical activity, and age.

2008

Objective: This study evaluated to what extent dual-energy X-ray absorptiometry (DXA) and two types of bioimpedance analysis (BIA) yield similar results for body fat mass (FM) in men and women with different levels of obesity and physical activity (PA). Methods and Procedures: The study population consisted of 37–81-year-old Finnish people (82 men and 86 women). FM% was estimated using DXA (GE Lunar Prodigy) and two BIA devices (InBody (720) and Tanita BC 418 MA). Subjects were divided into normal, overweight, and obese groups on the basis of clinical cutoff points of BMI, and into low PA (LPA) and high PA (HPA) groups. Agreement between the devices was calculated by using the Bland–Altman …

AdultMalemedicine.medical_specialtyEndocrinology Diabetes and MetabolismPhysical activityMedicine (miscellaneous)OverweightBody weightFat massEndocrinologyAbsorptiometry PhotonSex FactorsmedicineElectric ImpedanceBody Fat DistributionHumansObesityExerciseFinlandAgedNutrition and Dieteticsbusiness.industryAge FactorsReproducibility of ResultsNormal BMIMiddle AgedOverweightmedicine.diseaseObesityBioimpedance AnalysisPhysical therapyBody CompositionPopulation studyFemalemedicine.symptombusinessAlgorithmsObesity (Silver Spring, Md.)
researchProduct

COL1A1 Sp1 polymorphism associates with bone density in early puberty.

2006

Optimal acquisition of bone mass in puberty is a key determinant of the lifetime risk of osteoporosis and has a strong genetic basis. We investigated the relationship between the COL1A1 Sp1 polymorphism and BMD in early puberty, and how the genotypes relate to bone size and geometry as well as bone turnover and material properties in 247 10- to 13-year-old girls. Bone properties were measured using DXA, pQCT, and ultrasound. Also, serum P1NP, OC, B-ALP, and TRACP 5b were assessed. Our results showed that girls with the TT genotype had significantly lower BMC and BMD of the total body, lumbar spine, and proximal femur, as well as BUA at the calcaneus, than those with the GT and GG genotype. …

musculoskeletal diseasesPeak bone massmedicine.medical_specialtyHistologyTime FactorsBone densityAdolescentGenotypePhysiologyEndocrinology Diabetes and MetabolismOsteoporosisPuberty PrecociousCollagen Type IBone remodelingBone DensityInternal medicineGenotypeMedicineHumansChildPolymorphism GeneticProximal femurbusiness.industrymusculoskeletal systemmedicine.diseaseCollagen Type I alpha 1 ChainEndocrinologyFemaleCalcaneusbusinessBiomarkersEarly pubertyBone
researchProduct

OGT and OGA expression in postmenopausal skeletal muscle associates with hormone replacement therapy and muscle cross-sectional area

2013

Protein glycosylation via O-linked N-acetylglucosaminylation (O-GlcNAcylation) is an important post-translational regulatory mechanism mediated by O-GlcNAc transferase (OGT) and responsive to nutrients and stress. OGT attaches an O-GlcNAc moiety to proteins, while O-GlcNAcase (OGA) catalyzes O-GlcNAc removal. In skeletal muscle of experimental animals, prolonged increase in O-GlcNAcylation associates with age and muscle atrophy. Here we examined the effects of hormone replacement therapy (HRT) and power training (PT) on muscle OGT and OGA gene expression in postmenopausal women generally prone to age-related muscle weakness. In addition, the associations of OGT and OGA gene expressions with…

medicine.medical_specialtyAgingGlycosylationTime Factorsmedicine.drug_classPlyometric ExerciseBiologyta3111N-AcetylglucosaminyltransferasesBiochemistryGene Expression Regulation EnzymologicEndocrinologyDownregulation and upregulationInternal medicineGene expressionGeneticsmedicineHumansMuscle StrengthRNA Messengerta315Muscle SkeletalMolecular BiologyFinlandGlyceraldehyde 3-phosphate dehydrogenasePlyometric power trainingEstrogen Replacement Therapyta1182Age FactorsMuscle weaknessSkeletal muscleta3141Cell BiologyMiddle Agedbeta-N-AcetylhexosaminidasesMuscle atrophyPostmenopausePhenotypeTreatment OutcomeEndocrinologymedicine.anatomical_structureEstrogenbiology.proteinFemaleMuscle atrophymedicine.symptomProtein Processing Post-TranslationalMuscle ContractionMuscle contraction
researchProduct

Interactive effects of aging and aerobic capacity on energy metabolism-related metabolites of serum, skeletal muscle, and white adipose tissue

2021

ABSTRACTAerobic capacity is a strong predictor of longevity. With aging, aerobic capacity decreases concomitantly with changes in whole body metabolism leading to increased disease risk. To address the role of aerobic capacity, aging and their interaction on metabolism, we utilized rat models of low and high intrinsic aerobic capacity (LCRs/HCRs) and assessed the metabolomics of serum, muscle, and white adipose tissue (WAT). We compared LCRs and HCRs at two time points: Young rats were sacrificed at 9 months, and old rats were sacrificed at 21 months. Targeted and semi-quantitative metabolomics analysis was performed on ultra-pressure Liquid Chromatography Tandem Mass Spectrometry (UPLC-MS)…

0301 basic medicineAgingWhite adipose tissue030204 cardiovascular system & hematologychemistry.chemical_compound0302 clinical medicineTandem Mass SpectrometryMetabolitesaineenvaihduntametabolitesALL-CAUSE MORTALITY2. Zero hungerchemistry.chemical_classification0303 health sciencesmetabolomicsAmino acidmedicine.anatomical_structureCARDIOVASCULAR-DISEASEOBESITYaerobinen suorituskykyOriginal ArticleCARDIORESPIRATORY FITNESSARTIFICIAL SELECTIONmedicine.medical_specialtyAdipose Tissue WhiteEXERCISErasva-aineenvaihdunta03 medical and health sciencesMetabolomicsFATNESSAerobic capacityInternal medicinemedicineAnimalsMetabolomicsBeta (finance)Muscle SkeletalAerobic capacity030304 developmental biologyAMINO-ACID-METABOLISMFatty acid metabolismagingSkeletal muscleLipid metabolismCardiorespiratory fitnessMetabolismRatsaerobic capacityikääntyminen030104 developmental biologyEndocrinologyPHYSICAL-ACTIVITYchemistryFUEL SELECTIONaineenvaihduntatuotteet3111 Biomedicinekoe-eläinmallitGeriatrics and GerontologyEnergy MetabolismChromatography Liquid
researchProduct

Serum osteocalcin in relation to calcaneal bone mineral density in elderly men and women: a 5-year follow-up

2000

A 5-year follow-up study investigated serum concentrations of total (tOC) and intact (iOC) osteocalcin in relation to calcaneal bone mineral density (BMD). The study comprised two cohorts, 75- and 80-year-olds, both resident in the city of Jyvaskyla, Finland. Baseline OC and BMD were obtained for 161 men and 233 women, of whom 83 men and 189 women participated in follow-up bone measurements. The mean concentration of tOC increased from 9.6 +/- 4.3 to 13.2 +/- 8.5 microg/l (P = 0.001) in men and from 11.2 +/- 4.9 to 14.0 +/- 6.1 microg/l (P < 0.001) in women, whereas mean iOC decreased from 6.4 +/- 3.0 to 5.9 +/- 3.0 microg/l (P = 0.273) and from 7.7 +/- 3.7 to 6.9 +/- 3.4 microg/l (P = 0.02…

Malemedicine.medical_specialtyBone diseaseBone densityEndocrinology Diabetes and MetabolismOsteocalcinOsteoporosisBone remodelingCohort StudiesFractures BoneEndocrinologyBone DensityInternal medicinemedicineHumansOrthopedics and Sports MedicineProspective StudiesProspective cohort studyAgedBone mineralbiologybusiness.industryGeneral Medicinemedicine.diseaseCalcaneusEndocrinologyQuartileOsteocalcinbiology.proteinFemaleBone RemodelingbusinessFollow-Up StudiesJournal of Bone and Mineral Metabolism
researchProduct

Women With and Without Metabolic Disorder Differ in Their Gut Microbiota Composition

2012

The aim of this study was to investigate whether overweight/obese women in metabolic disorder group (MDG, n = 27) differ in their gut microbiota composition from overweight/obese women in non-metabolic disorder group (NMDG, n = 47) and normal weight women group (NWG, n = 11). Gut microbiota was profiled from fecal samples by 16S rRNA fluorescence in situ hybridization and flow cytometry in 85 premenopausal women. Body composition was measured by bioimpedance, and dietary intakes were collected via food diaries. Standard procedures were used to assess plasma glucose, serum insulin, lipids, and inflammatory status. We found that the proportion of bacteria belonging to Eubacterium rectale-Clos…

Adultmedicine.medical_specialtyEndocrinology Diabetes and MetabolismColony Count MicrobialMedicine (miscellaneous)Intra-Abdominal FatGut floraOverweightBody Mass IndexFecesEndocrinologyPredictive Value of TestsInternal medicinemedicineHumansEubacteriumFinlandIn Situ Hybridization FluorescenceFecesClostridiumMetabolic SyndromeAnalysis of VarianceNutrition and Dieteticsbiologybusiness.industryta1183Metabolic disorderta3141Middle AgedFlow Cytometrybiology.organism_classificationmedicine.diseaseObesityGastrointestinal TractEndocrinologyBody CompositionFemalemedicine.symptombusinessBody mass indexLipoproteinObesity
researchProduct

Effect of Chronic Exercise Training on Blood Lactate Metabolism Among Patients With Type 2 Diabetes Mellitus : A Systematic Review and Meta-Analysis

2021

Purpose: To assess the effect of chronic exercise training on blood lactate metabolism at rest (i.e., basal lactate concentrations) and during exercise (i.e., blood lactate concentration at a fixed load, load at a fixed blood lactate concentration, and load at the individual blood lactate threshold) among patients with type 2 diabetes mellitus (T2DM).Methods: PubMed (MedLine), Embase, Web of Science, and Scopus were searched. Randomized controlled trials, non-randomized controlled trials, and case-control studies using chronic exercise training (i.e., 4 weeks) and that assessed blood lactate concentrations at rest and during exercise in T2DM patients were included.Results: Thirteen studies …

medicine.medical_specialtySports medicinePhysiologyT2DMbiomarkkerithyperlactatemialcsh:Physiologylaw.inventionchemistry.chemical_compoundphysical trainingaineenvaihduntahäiriötRandomized controlled triallawPhysiology (medical)medicineaineenvaihduntasystemaattiset kirjallisuuskatsauksetlcsh:QP1-981sports medicinebusiness.industrykuntoliikuntaLactate thresholdmeta-analyysilactic acidType 2 Diabetes Mellituslactate thresholdlaktaatitLactic acidBasal (medicine)chemistryAnesthesiaMeta-analysisHyperlactatemiaSystematic Reviewbusinessaikuistyypin diabetesfysiologiset vaikutukset
researchProduct

Effect of aerobic exercise and low carbohydrate diet on pre-diabetic non-alcoholic fatty liver disease in postmenopausal women and middle aged men - …

2014

Background Pre-diabetes and non-alcoholic fatty liver disease (NAFLD) are associated with an unhealthy lifestyle and pose extremely high costs to the healthcare system. In this study, we aim to explore whether individualized aerobic exercise (AEx) and low carbohydrate diet (LCh) intervention affect hepatic fat content (HFC) in pre-diabetes via modification of gut microbiota composition and other post-interventional effects. Methods/design A 6-month randomized intervention with 6-month follow-up is conducted from January 2013 to December 2015. The target sample size for intervention is 200 postmenopausal women and middle-aged men aged 50–65 year-old with pre-diabetes and NAFLD. The qualified…

MaleHealth BehaviorPATHOGENESISPhysiologyGut floralaw.inventionImpaired glucose toleranceDiet Carbohydrate-RestrictedStudy ProtocolRandomized controlled trialNon-alcoholic Fatty Liver DiseaselawSurveys and QuestionnairesEPIDEMIOLOGYGlucose metabolismbiologyMicrobiotaFatty liverMiddle AgedPostmenopauseLiverResearch DesignMetabonomicsOBESITYBody CompositionFemaleLIFE-STYLELiver fat contentHumanmedicine.medical_specialtyGut microbiotaCarbohydrate metabolismCHINAPrediabetic StateIMPAIRED GLUCOSE-TOLERANCEDiabetes mellitusInternal medicineDietary CarbohydratesmedicineHumansAerobic exerciseExerciseLife StyleAgedbusiness.industryPublic Health Environmental and Occupational HealthDIABETES-MELLITUSFeeding BehaviorADULTSmedicine.diseasebiology.organism_classificationObesityGastrointestinal TractClinical settingMICEEndocrinologyLipid metabolismDietary SupplementsbusinessBMC Public Health
researchProduct

Self-selected running gait modifications reduce acute impact loading, awkwardness, and effort

2021

Impact loading has been associated with running-related injuries, and gait retraining has been suggested as a means of reducing impact loading and lowering the risk of injury. However, gait retraining can lead to increased perceived awkwardness and effort. The influence of specifically trained and self-selected running gait modifications on acute impact loading, perceived awkwardness and effort is currently unclear. Sixteen habitual rearfoot/midfoot runners performed forefoot strike pattern, increased step rate, anterior trunk lean and self-selected running gait modifications on an instrumented treadmill based on real-time biofeedback. Impact loading, perceived awkwardness and effort scores…

medicine.medical_specialtyGait retrainingbusiness.industry0206 medical engineeringPhysical Therapy Sports Therapy and Rehabilitation030229 sport sciences02 engineering and technology020601 biomedical engineeringbody regions03 medical and health sciencesRunning gait0302 clinical medicinePhysical medicine and rehabilitationGait (human)Impact loadingmedicineOrthopedics and Sports Medicinebusinesshuman activitiesSports Biomechanics
researchProduct

Bone and body segment lengthening and widening: a 7-year follow-up study in pubertal girls.

2010

Abstract During growth bone increases in length and width as does the body size. The aim of this paper was to examine the growth pattern of body height and weight, and the width and length of various body segments, and to establish the timing of peak growth velocity (PV) in relation to time of menarche in a cohort of Finnish girls followed from age 10 until 18. The study was a 7-year longitudinal cohort study. Widths and lengths of body segments and bones were measured from DXA scan images using bone landmarks in 396 girls aged 10 to 13 years at baseline, and in 255 mothers and 159 grandmothers. The girls' growth velocities (rate of change with time) peaked at 13.5 months prior to menarche …

AdultHistologyAdolescentPhysiologyEndocrinology Diabetes and MetabolismBody Mass IndexMedicineHumansFemurHumerusTibiaLongitudinal StudiesChildDual-energy X-ray absorptiometryPelvisFinlandAgedAged 80 and overMenarcheBone Developmentmedicine.diagnostic_testbusiness.industryBody WeightPubertyAnatomyMiddle AgedTrunkBody Heightmedicine.anatomical_structureMenarcheFemalebusinessBody mass indexFollow-Up StudiesBone
researchProduct

PO-185 Lifestyle intervention modify DNA methylation of adipose tissue in overweight and obese men with insomnia symptoms

2018

Objective To study whether diet and exercise intervention affect sleep and obesity-related genes’ DNA methylation in overweight and obese men with insomnia symptoms&#x0D; Methods The study participants were a subgroup of a large intervention and consisted of 10 overweight or obesity men aged 34-65 years with insomnia symptoms. They participated in a 6-month progressive aerobic exercise training and individualized dietary consoling program and were randomly selected from diet (n=4), exercise (n=3) and control (n=3) groups. Body composition included fat mass and lean mass in the whole body and abdominal android region were assessed by dual-energy X-ray densitometry. The fitness level (VO2max)…

medicine.medical_specialtyCholesterolbusiness.industryAdipose tissueMethylationOverweightmedicine.diseaseObesitychemistry.chemical_compoundEndocrinologychemistryInternal medicineDNA methylationLean body massMedicineAerobic exercisemedicine.symptombusinessExercise Biochemistry Review
researchProduct

Serum Amino Acid Profiles in Childhood Predict Triglyceride Level in Adulthood: A 7-Year Longitudinal Study in Girls.

2016

AbstractContext:Branched-chain and aromatic amino acids are associated with high risk of developing dyslipidemia and type II diabetes in adults.Objective:This study aimed to examine whether serum amino acid profiles associate with triglyceride concentrations during pubertal growth and predict hypertriglyceridemia in early adulthood.Design:This was a 7.5-year longitudinal study.Setting:The study was conducted at the Health Science Laboratory, University of Jyväskylä.Participants:A total of 396 nondiabetic Finnish girls aged 11.2 ± 0.8 years at the baseline participated in the study.Main Outcome Measures:Body composition was assessed by dual-energy x-ray absorptiometry; serum concentrations o…

0301 basic medicineBlood GlucoseLongitudinal studymedicine.medical_specialtyMagnetic Resonance SpectroscopyAdolescentEndocrinology Diabetes and Metabolismmedicine.medical_treatmentClinical BiochemistryContext (language use)030204 cardiovascular system & hematologyBiochemistry03 medical and health scienceschemistry.chemical_compound0302 clinical medicineEndocrinologyAbsorptiometry PhotonInternal medicinemedicineHumansInsulinLongitudinal StudiesAmino AcidsChildTriglyceridesTriglyceridebusiness.industryInsulinBiochemistry (medical)Hypertriglyceridemiamedicine.disease030104 developmental biologyEndocrinologychemistryBody CompositionFemaleIsoleucineLeucinebusinessDyslipidemiaThe Journal of clinical endocrinology and metabolism
researchProduct

Effects of 32-year leisure time physical activity discordance in twin pairs on health (TWINACTIVE study): aims, design and results for physical fitne…

2009

AbstractThe physically active lifestyle is associated with low future morbidity and mortality, but the causality between physical activity and health is not always clear. As some inherited biological characteristics and childhood experiences may cause selection bias in observational studies, we sought to take them into account by identifying 16 twin pairs (7 MZ, 9 DZ, mean age 60 years) discordant for leisure time physical activity habits for thirty years. We conducted detailed health-related examinations among these twin pairs. Our main aims were to study the effects of physical activity and genes on fitness and body composition, with special reference to body fat compartments, metabolic s…

GerontologyAdultMalemedicine.medical_specialtyAdolescentmedia_common.quotation_subjectPhysical fitnessEpidemiologymedicineTwins DizygoticHumansRisk factorGenetics (clinical)media_commonRetrospective StudiesSelection biasMetabolic Syndromebusiness.industryObstetrics and GynecologyTwins MonozygoticMiddle Agedmedicine.diseaseCausalityTwin studyAdipose TissuePhysical FitnessPediatrics Perinatology and Child HealthChronic DiseaseObservational studyFemaleMetabolic syndromebusinessFollow-Up StudiesTwin research and human genetics : the official journal of the International Society for Twin Studies
researchProduct

Branched-Chain and Aromatic Amino Acids Are Associated With Insulin Resistance During Pubertal Development in Girls.

2018

Cross-sectional studies in children show branched-chain and aromatic amino acids are associated with insulin resistance, but whether these associations persist from childhood to adulthood is not known. This study aimed to assess whether circulating amino acids associate with insulin resistance during pubertal development.This was a 7.5-year longitudinal study from childhood to early adulthood. A total of 396 nondiabetic Finnish girls aged 11.2 ± .8 years at baseline participated in the study which was conducted at the Health Science Laboratory, University of Jyväskylä. Serum concentrations of glucose and insulin were determined by enzymatic photometric methods and amino acids by nuclear mag…

Blood Glucosemedicine.medical_specialtyLongitudinal studyAdolescentmedicine.medical_treatmentBody Mass Index03 medical and health scienceschemistry.chemical_compoundAmino Acids Aromatic0302 clinical medicineInsulin resistance030225 pediatricsInternal medicineHyperinsulinemiaAromatic amino acidsMedicineHumansInsulin030212 general & internal medicineLongitudinal StudiesChildchemistry.chemical_classificationMenarchebusiness.industryInsulinPublic Health Environmental and Occupational Healthmedicine.diseaseAmino acidPsychiatry and Mental healthEndocrinologychemistryPediatrics Perinatology and Child HealthMenarcheHomeostatic model assessmentFemaleInsulin ResistancebusinessAmino Acids Branched-ChainThe Journal of adolescent health : official publication of the Society for Adolescent Medicine
researchProduct

Supervised Physical Training Enhances Muscle Strength but Not Muscle Mass in Prostate Cancer Patients Undergoing Androgen Deprivation Therapy: A Syst…

2019

Introduction: Androgen deprivation therapy (ADT) is considered the basic treatment for advanced prostate cancer, but it is highly associated with detrimental changes in muscle mass and muscle strength. The aim of this meta-analysis was to investigate the effects of supervised physical training on lean mass and muscle strength in prostate cancer patients undergoing ADT. Methods: A systematic literature search was performed using MEDLINE, Embase, and ScienceDirect until October 2018. Only studies that examined both muscle mass and strength in prostate cancer patients undergoing ADT were included. Outcomes of interest were changes in lean body mass (surrogate for muscle mass) as well as upper …

Oncologymedicine.medical_specialtyPhysiologyStrength trainingADTAndrogen suppressionlcsh:PhysiologyAndrogen deprivation therapy03 medical and health sciencesProstate cancer0302 clinical medicineProstatelean massPhysiology (medical)Internal medicinestrength trainingmedicineexercise medicineexercise oncologyLeg presssystemaattiset kirjallisuuskatsauksetandrogen suppressionsyöpähoidotlcsh:QP1-981business.industrymeta-analyysiCorrection030229 sport sciencesmedicine.diseasemedicine.anatomical_structurelihasmassa030220 oncology & carcinogenesisLean body massProstate neoplasmSystematic ReviewvoimaharjoittelubusinessliikuntahoitolihasvoimaFrontiers in Physiology
researchProduct

Towards early risk biomarkers: serum metabolic signature in childhood predicts cardio-metabolic risk in adulthood

2019

AbstractCardiovascular diseases have their origin in childhood. Early biomarkers identifying individuals with increased risk for disease are needed to support early detection and to optimize prevention strategies. By applying machine learning approach on high throughput NMR-based metabolomics data, we identified metabolic predictors of cardiovascular risk in circulation in a cohort of 396 females, followed from childhood (mean age 11.2 years) to early adulthood (mean age 18.1 years). The identified childhood metabolic signature included three circulating biomarkers robustly associating with increased cardiovascular risk in early adulthood (AUC = 0.641 to 0.802, all p&lt;0.01). These associa…

Oncologymedicine.medical_specialtybusiness.industryEarly detectionCardio metabolic riskMean ageDiseaseCirculating biomarkersIncreased riskInternal medicineCohortEarly adulthoodmedicinebusiness
researchProduct

Bone’s Structural Diversity in Adult Females Is Established before Puberty

2009

Bone must be rigid for leverage yet light for mobility. We studied how bone modeling and remodeling fashioned differences in bone size, shape, and mass during growth to achieve these properties in adulthood.We measured the structural features of a tibial cross-section using quantitative computed tomography and markers of remodeling in 258 10- to 13-yr-old girls during 2 yr and in 108 of their mothers.Tibia total cross-sectional area and mass correlated between daughters and their mothers (r = 0.34 and 0.44, respectively, both P0.01). The location of a daughter's tibial total cross-sectional area, medullar area, and bone mass in the lower, middle, or upper part of the sample distribution was…

Adultmedicine.medical_specialtyAdolescentEndocrinology Diabetes and Metabolismmedia_common.quotation_subjectClinical BiochemistryStructural diversityBiologyBiochemistryBone and BonesBone modelingFractures BoneEndocrinologyBone DensityInternal medicinemedicineHumansTibiaQuantitative computed tomographyChildmedia_commonBone mineralDaughterBone DevelopmentAnthropometryTibiamedicine.diagnostic_testPubertyBiochemistry (medical)Nutritional statusMiddle AgedEndocrinologyFemaleBone RemodelingBone massThe Journal of Clinical Endocrinology &amp; Metabolism
researchProduct

Corrigendum to “Low volumetric BMD is linked to upper-limb fracture in pubertal girls and persists into adulthood: A seven-year cohort study” [Bone 4…

2010

a Department of Health Sciences, University of Jyvaskyla, Jyvaskyla, Finland b Department of Orthopaedics and Traumatology, Kuopio University Hospital, Kuopio, Finland c Department of Preventive Medicine, University of Tennessee Health Science Center, USA d Endocrine Centre, Heidelberg Repatriation Hospital, Austin Health/Department of Medicine, University of Melbourne, Australia e Department of Medical Rehabilitation, Oulu University Hospital and Institute of Health Sciences, University of Oulu, Oulu, Finland

medicine.medical_specialtyHistologyPhysiologybusiness.industryEndocrinology Diabetes and MetabolismUpper Limb FractureMedical rehabilitationTraumatologyUniversity hospitalhumanitiesHealth scienceFamily medicinemedicinePhysical therapybusinessBiomedical sciencesCohort studyBone
researchProduct

BMI and an anthropometry-based estimate of fat mass percentage are both valid discriminators of cardiometabolic risk: A comparison with DXA and bioim…

2013

Objective. To determine whether categories of obesity based on BMI and an anthropometry-based estimate of fat mass percentage (FM% equation) have similar discriminative ability for markers of cardiometabolic risk as measurements of FM% by dual-energy X-ray absorptiometry (DXA) or bioimpedance analysis (BIA).Design and Methods. A study of 40–79-year-old male (n=205) and female (n=388) Finns. Weight, height, blood pressure, triacylglycerols, HDL cholesterol, and fasting blood glucose were measured. Body composition was assessed by DXA and BIA and a FM%-equation.Results. For grade 1 hypertension, dyslipidaemia, and impaired fasting glucose &gt;6.1 mmol/L, the categories of obesity as defined b…

AdultMalelcsh:Internal medicinemedicine.medical_specialtyArticle SubjectEndocrinology Diabetes and MetabolismBody Mass IndexBMIAbsorptiometry PhotonPredictive Value of Testscardiometabolic riskInternal medicinefat mass percentagebioimpedanceElectric ImpedancemedicineHumansObesitylcsh:RC31-1245AgedDXACardiometabolic riskNutrition and DieteticsAnthropometrybusiness.industryReproducibility of ResultsPublic Health Global Health Social Medicine and Epidemiologyta3141Middle AgedAnthropometryImpaired fasting glucosemedicine.diseaseObesityConfidence intervalNäringsläraFolkhälsovetenskap global hälsa socialmedicin och epidemiologiBlood pressureEndocrinologyAdipose TissueROC CurvePredictive value of testsBody CompositionCardiologyFemalebusinessBody mass indexResearch ArticleJournal of Obesity
researchProduct

Preliminary Findings: 25(OH)D Levels and PTH Are Indicators of Rapid Bone Accrual in Pubertal Children

2007

The objective of this study was to evaluate the role of serum levels of 25(OH)D and PTH on the accumulation of whole body bone mass in a cohort of children.This was a longitudinal study (1.98 +/- 0.07 y) of sixty-nine children (89% Caucasian, 44% male) enrolled in a calcium supplementation trial. Bone area, bone mineral content (BMC) and density (BMD) of the whole body and radius were assessed using a QDR 2000 (Hologic, Inc) dual energy x-ray absorptiometer. Serum PTH and 25(OH)D were measured using radioimmunoassays.Vitamin D stores were inversely related gain in bone area (p0.002), BMC (p0.002) BMD (p0.027), as well as to PTH levels (p0.0001). Compared to those with adequate vitamin D sto…

Malemedicine.medical_specialtyAdolescentBone accrualAcid PhosphataseRadioimmunoassayMedicine (miscellaneous)Parathyroid hormonechemistry.chemical_elementCalciumBone and BonesCohort StudiesAbsorptiometry PhotonBone DensityInternal medicineVitamin D and neurologymedicineHumansLongitudinal StudiesVitamin DChildDual-energy X-ray absorptiometryNutrition and DieteticsBone Density Conservation Agentsmedicine.diagnostic_testChemistryPubertyCalcium DietaryEndocrinologySocial ClassParathyroid HormoneDietary SupplementsCohortReceptors CalcitriolFemaleChild Nutritional Physiological PhenomenaBiomarkersCohort studyBone massJournal of the American College of Nutrition
researchProduct

Insulin resistance is associated with altered amino acid metabolism and adipose tissue dysfunction in normoglycemic women

2016

AbstractInsulin resistance is associated adiposity, but the mechanisms are not fully understood. In this study, we aimed to identify early metabolic alterations associated with insulin resistance in normoglycemic women with varying degree of adiposity. One-hundred and ten young and middle-aged women were divided into low and high IR groups based on their median HOMA-IR (0.9 ± 0.4 vs. 2.8 ± 1.2). Body composition was assessed using DXA, skeletal muscle and liver fat by proton magnetic resonance spectroscopy, serum metabolites by nuclear magnetic resonance spectroscopy and adipose tissue and skeletal muscle gene expression by microarrays. High HOMA-IR subjects had higher serum branched-chain …

0301 basic medicineBlood Glucosemedicine.medical_specialtySubcutaneous FatAdipose tissueGene Expression030209 endocrinology & metabolismInflammationamino acid metabolismBiology3121 Internal medicineta3111Article03 medical and health sciences0302 clinical medicineInsulin resistanceInternal medicineGene expressionmedicineHumansAmino AcidsPhosphorylationMuscle Skeletalchemistry.chemical_classificationInflammationadiposityMultidisciplinaryAnthropometryCatabolismSisätaudit - Internal medicineSkeletal muscleNaisten- ja lastentaudit - Gynaecology and paediatricsmedicine.diseaseinsuliiniresistenssi113 Computer and information sciencesAmino acidadipose tissue3141 Health care science030104 developmental biologyEndocrinologymedicine.anatomical_structurechemistryAdipose TissueBody CompositionFemaleSignal transductionmedicine.symptomInsulin ResistanceSignal TransductionScientific Reports
researchProduct

Monitoring bone growth using quantitative ultrasound in comparison with DXA and pQCT.

2008

Quantitative ultrasound (QUS) is a safe, inexpensive, and nonradiation method for bone density assessment. QUS correlates with, and predicts fragility fractures comparable to, dual-energy X-ray absorptiometry (DXA)-derived bone mineral density (BMD) in postmenopausal women. However, its validity in monitoring bone growth in children is not well understood. Two hundred and fifty-eight 10-13 yr pubertal girls and 9 37-43 yr adults without diseases or history of medications known to affect bone metabolism were included in the 2-yr prospective study. Calcaneal broadband ultrasound attenuation (cBUA) was assessed using QUS-2 (Quidel, Santa Clara, CA), speed of sound of tibial shaft (tSOS) using …

musculoskeletal diseasesAdultmedicine.medical_specialtyBone densityAdolescentEndocrinology Diabetes and MetabolismBone remodelingFractures BoneAbsorptiometry PhotonBone DensityMedicineHumansRadiology Nuclear Medicine and imagingOrthopedics and Sports MedicineProspective StudiesQuantitative computed tomographyProspective cohort studyChildFemoral neckUltrasonographyBone growthBone mineralmedicine.diagnostic_testbusiness.industryReproducibility of ResultsConcordance correlation coefficientmedicine.anatomical_structureFemaleRadiologybusinessNuclear medicineTomography X-Ray ComputedJournal of clinical densitometry : the official journal of the International Society for Clinical Densitometry
researchProduct

Is bone loss the reversal of bone accrual? Evidence from a cross-sectional study in daughter-mother-grandmother trios.

2011

Bone adapts to mechanical loads applied on it. During aging, loads decrease to a greater extent at those skeletal sites where loads increase most in earlier life. Thus, the loss of bone may occur preferentially at sites where most bone has been deposited previously; ie, bone loss could be the directional reversal of accrual. To test this hypothesis, we compared the bone mass distribution at weight-bearing (tibia) and non-weight-bearing (radius) bones among 18-year-old girls, their premenopausal mothers, and their postmenopausal maternal grandmothers. Bone and muscle properties were measured by pQCT, and polar distribution of bone mass was obtained in 55 girl-mother–maternal grandmother trio…

AdultBone accrualAdolescentCross-sectional studyEndocrinology Diabetes and Metabolismmedia_common.quotation_subjectDentistryMothersBone and BonesNuclear FamilyMechanostatBone DensitymedicineHumansOrthopedics and Sports MedicineTibiaBone Resorptionmedia_commonAgedDaughterTibiabusiness.industryMusclesBone agemedicine.diseaseMiddle ageOsteopeniaRadiusCross-Sectional StudiesFemalebusinessJournal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research
researchProduct

Differential effects of sex hormones on peri- and endocortical bone surfaces in pubertal girls.

2005

Context: The role of sex steroids in bone growth in pubertal girls is not yet clear. Bone biomarkers are indicators of bone metabolic activity, but their value in predicting bone quality has not been studied in growing girls. Objective: This study examines the association of sex hormones and bone markers with bone geometry and density in pubertal girls. Design: The study was designed as a 2-yr longitudinal study in pubertal girls. Measurements were performed at baseline and at 1and 2-yr follow-ups. Setting: The study was conducted in a university laboratory. Participants: A total of 258 10- to 13-yr-old healthy girls at the baseline participated. Methods:Peripheralquantitativecomputedtomogr…

medicine.medical_specialtyBone densityAdolescentEndocrinology Diabetes and MetabolismClinical BiochemistryLong boneAcid PhosphataseOsteocalcinContext (language use)BiochemistryBone resorptionEndocrinologySex hormone-binding globulinBone DensityInternal medicineSex Hormone-Binding GlobulinmedicineHumansTestosteroneChildGonadal Steroid HormonesBone growthBone mineralMenarcheBone DevelopmentbiologyEstradiolTibiabusiness.industryTartrate-Resistant Acid PhosphataseBiochemistry (medical)PubertyAlkaline PhosphataseIsoenzymesmedicine.anatomical_structureEndocrinologyOsteocalcinbiology.proteinLinear ModelsFemalebusinessBiomarkersThe Journal of clinical endocrinology and metabolism
researchProduct

Adipocytes as a Link Between Gut Microbiota-Derived Flagellin and Hepatocyte Fat Accumulation

2016

While the role of both elevated levels of circulating bacterial cell wall components and adipose tissue in hepatic fat accumulation has been recognized, it has not been considered that the bacterial components-recognizing adipose tissue receptors contribute to the hepatic fat content. In this study we found that the expression of adipose tissue bacterial flagellin (FLG)-recognizing Toll-like receptor (TLR) 5 associated with liver fat content (r = 0.699, p = 0.003) and insulin sensitivity (r = -0.529, p = 0.016) in humans (n = 23). No such associations were found for lipopolysaccharides (LPS)-recognizing TLR4. To study the underlying molecular mechanisms of these associations, human HepG2 he…

0301 basic medicineGlycerollcsh:MedicineAdipose tissueWhite adipose tissueflagellinBiochemistryImmune ReceptorsFatsEndocrinologyAnimal CellsAdipocytesMedicine and Health SciencesInsulinlcsh:ScienceToll-like ReceptorsConnective Tissue CellsMultidisciplinaryImmune System ProteinsbiologyLiver DiseasesFatty liverin kaltaiset reseptorit [toll]Lipidsadipose tissuePhysical sciencesChemistryMitochondrial respiratory chainAdipose TissueConnective Tissuebacterial componentsCellular TypesAnatomyinsuline sensitivityResearch ArticleSignal Transductionmedicine.medical_specialtyadipocytesImmunologyMonomers (Chemistry)Gastroenterology and Hepatologyta311103 medical and health sciencesInsulin resistanceInternal medicinemedicinePolymer chemistryDiabetic Endocrinologylcsh:Rta1183ta1182Biology and Life SciencesProteinsCell Biologyliver fatmedicine.diseasehepatic fatfat accumulationHormonesIRS1Fatty LiverInsulin receptor030104 developmental biologyEndocrinologyBiological TissueTLR5biology.proteinlcsh:QPLoS ONE
researchProduct

Effects of aerobic exercise on home-based sleep among overweight and obese men with chronic insomnia symptoms: a randomized controlled trial

2016

Objective: To determine the effect of a six-month aerobic exercise program on home-based sleep quality among overweight and obese men with chronic insomnia symptoms. Methods: Participants were 45 Finnish men (93% had body mass index >= 25) aged 30-65 years, with chronic months) insomnia symptoms as classified by the DSM-IV criteria. Participants were randomized into an exercise (n = 24) or control group (n = 21). The exercise group received six-month aerobic exercise intervention with one to five sessions per week of 30-60 minutes duration. The control group was instructed to maintain habitual lifestyle behaviors during the study period. Seven-night home sleep was measured with a piezoelect…

MalePhysical fitnessOverweightinsomnia symptoms3124 Neurology and psychiatry0302 clinical medicineSleep Initiation and Maintenance DisordersSurveys and QuestionnairesInsomniasleep onsetCOGNITIVE-BEHAVIORAL THERAPYta315SCALEFinlandASSOCIATIONS2. Zero hungerAnthropometryexerciseylipainota3141General MedicineMiddle AgedSleep diarymedicine.symptomSleep onsetPsychologyAdultmedicine.medical_specialtyDISORDERSDIAGNOSIS03 medical and health sciencesCOMPLAINTSmedicineQUALITYHumansoverweightAerobic exercisehome-based sleepObesityOLDER-ADULTSLife StyleAgedbusiness.industry3112 Neurosciences030229 sport sciencesDietPHYSICAL-ACTIVITY3121 General medicine internal medicine and other clinical medicinePhysical therapypiezoelectricSleep onset latencySleepbusinessBody mass index030217 neurology & neurosurgeryPSYCHOPHYSIOLOGICAL INSOMNIASleep Medicine
researchProduct

Effects of hormone replacement therapy and high-impact physical exercise on skeletal muscle in post-menopausal women: a randomized placebo-controlled…

2001

An age-related decline in muscle performance is a known risk factor for falling, fracture and disability. In women, a clear deterioration is observed from early menopause. The effect of hormone replacement therapy (HRT) in preserving muscle performance is, however, unclear. This trial examined the effects of a 12-month HRT and high-impact physical exercise regimen on skeletal muscle in women in early menopause. A total of 80 women aged 50–57 years were assigned randomly to one of four groups: exercise (Ex), HRT, exercise+HRT (ExHRT) and control (Co). The exercise groups participated in a high-impact training programme. The administration of HRT (oestradiol/noretisterone acetate) or placebo …

medicine.medical_specialtyPlacebo-controlled studyPhysical exercisePlacebolaw.inventionDouble-Blind MethodRandomized controlled triallawInternal medicineElectric ImpedancemedicineHumansExercise physiologyMuscle SkeletalExerciseAnalysis of VarianceEstradiolbusiness.industryEstrogen Replacement TherapySkeletal muscleGeneral MedicineMiddle Agedmedicine.diseaseCombined Modality TherapyBiomechanical PhenomenaPostmenopauseMenopausemedicine.anatomical_structureEndocrinologyTorqueAnesthesiaBody CompositionFemaleNorethindronemedicine.symptomTomography X-Ray ComputedbusinessMuscle contractionClinical Science
researchProduct

Effect of alendronate and exercise on bone and physical performance of postmenopausal women: a randomized controlled trial.

2003

In this randomized, double-blind, placebo-controlled 12-month trial we evaluated effects of weight- bearing jumping exercise and oral alendronate, alone or in combination, on the mass and structure of bone, risk factors for falling (muscle strength and power, postural sway, and dynamic balance), and cardiorespiratory fitness in postmenopausal women. A total of 164 healthy, sedentary, early postmenopausal women were randomly assigned to one of four experimental groups: (1) 5 mg of alendronate daily plus progressive jumping exercise, (2) 5 mg alendronate, (3) placebo plus progressive jumping exercise, or (4) placebo. The primary endpoint was 12-month change in bone mass and geometry (measured…

medicine.medical_specialtyHistologyBone diseasePhysiologyEndocrinology Diabetes and MetabolismOsteoporosisUrologyPhysical exerciseBone remodelingDouble-Blind MethodBone DensityRisk FactorsmedicineConfidence IntervalsHumansExercise physiologyExerciseFemoral neckLumbar VertebraeAlendronatebusiness.industryFemur NeckAlendronic acidMiddle Agedmedicine.diseaseSurgeryPostmenopausemedicine.anatomical_structureCortical boneFemaleBone Remodelingbusinessmedicine.drugBone
researchProduct

Effect of exercise and dietary intervention on serum metabolomics in men with insomnia symptoms: a 6-month randomized-controlled trial

2020

AbstractBackgroundAccumulating evidences have shown that lifestyle interventions such as exercise and diet are associated with improved sleep quality. However, the underlying molecular mechanisms remain unclear. Assessing exercise and diet intervention associated changes in circulating metabolomics profile in people with insomnia symptoms may help to identify molecular biomarkers that may link lifestyle changes to improved sleep outcomes.MethodsThe present study is a part of a 6-month randomized lifestyle intervention on sleep disorder subjects. Seventy-two Finnish men (aged: 51.6 ± 10.1 years; body mass index, BMI: 29.3 ± 3.9 kg/m2) with chronic insomnia symptoms who were assigned into dif…

Sleep disorderbusiness.industryPhysiologyCarbohydrate metabolismmedicine.diseaselaw.inventionRandomized controlled triallawHeart rateInsomniamedicineAerobic exercisemedicine.symptombusinessBody mass indexMorning
researchProduct

Change in bone mass distribution induced by hormone replacement therapy and high-impact physical exercise in post-menopausal women.

2002

The purpose of this intervention trial was to determine whether changes in bone mass distribution could be observed in postmenopausal women following hormone replacement therapy (HRT) and/or high-impact physical exercise. Eighty healthy women, aged 50-57 years, at5 years after the onset of menopause and with no previous use of HRT, were randomly assigned to one of four groups: HRT; exercise (Ex); HRT + Ex (ExHRT); and control (Co). HRT administration was conducted in a double-blind manner for 1 year using estradiol plus noretisterone acetate (Kliogest). The exercise groups participated in a 1 year progressive training program consisting of jumping and bounding activities. Subjects participa…

medicine.medical_specialtyHistologyBone diseaseBone densityPhysiologyEndocrinology Diabetes and MetabolismOsteoporosisUrologyPhysical exerciseDouble-Blind MethodBone DensitymedicineHumansTibiaQuantitative computed tomographyExerciseBone mineralAnalysis of Variancemedicine.diagnostic_testEstradiolbusiness.industryEstrogen Replacement TherapyMiddle Agedmedicine.diseaseSurgeryPostmenopauseNorethindrone Acetatemedicine.anatomical_structureCortical boneFemalesense organsNorethindronebusinessBone
researchProduct

Metabolic response to 6-week aerobic exercise training and dieting in previously sedentary overweight and obese pre-menopausal women: A randomized tr…

2014

AbstractBackground: The aim of this study was to compare 6 weeks short-term moderate intensity aerobic exercise and dieting on serum metabolomicsand cardio-metabolic risk factors in pre-menopausal women.Methods: Ninety previously inactive overweight and obese (BMI 25e35 kg/m 2 ) women (age 41.5 7.6 years) were randomized to either a6-week Nordic walking exercise program (EX, n ¼ 45) or dietary counseling group (DI, n ¼ 45). Body composition, serum glucose, insulin andlipids were measured. Serum low-molecular-weight metabolites and lipid constituents were analyzed by nuclear magnetic resonance spec-troscopy. Measurements were done at baseline and 7 days after the last training session.Result…

medicine.medical_specialtymedicine.medical_treatmentDietingPhysical Therapy Sports Therapy and RehabilitationOverweightlaw.inventionlcsh:GV557-1198.995Insulin resistanceRandomized controlled trialWeight losslawInternal medicinemedicineMetabolomicsAerobic exerciseWomenOrthopedics and Sports Medicinelcsh:Sports medicineExerciselcsh:Sportsbusiness.industryInsulinta3141Metabolismmedicine.diseaseMetabolismEndocrinologymedicine.symptomlcsh:RC1200-1245businessDietingJournal of Sport and Health Science
researchProduct

Prolonged breast-feeding protects mothers from later-life obesity and related cardio-metabolic disorders

2011

AbstractObjectiveTo investigate the long-term effects of duration of postpartum lactation on maternal body composition and risk for cardio-metabolic disorders in later life.DesignRetrospective study. Body composition was measured using dual-energy X-ray absorptiometry and serum glucose, insulin and lipids were analysed using enzymatic photometric methods 16–20 years after the last pregnancy. Medical history and lifestyle factors were collected via a self-administered questionnaire. Detailed information regarding weight change patterns during each pregnancy was obtained from personal maternity tracking records.SettingCity of Jyväskylä and surroundings in Central Finland.SubjectsTwo hundred a…

AdultBlood Glucosemedicine.medical_specialtymedicine.medical_treatmentMothersMedicine (miscellaneous)PhysiologyBlood PressureMotor ActivityBody Mass IndexAbsorptiometry PhotonInsulin resistanceSurveys and QuestionnairesInternal medicinemedicineHumansInsulinLactationObesityLife StyleFinlandTriglyceridesRetrospective StudiesMetabolic SyndromePregnancyNutrition and Dieteticsbusiness.industryInsulinBody WeightCholesterol HDLWeight changePublic Health Environmental and Occupational Healthta3141Cholesterol LDLMiddle Agedmedicine.diseaseObesityBreast FeedingBlood pressureEndocrinologyBody CompositionEducational StatusFemaleInsulin ResistanceEnergy IntakebusinessBreast feedingBody mass indexPublic Health Nutrition
researchProduct

Leisure-time physical activity and high-risk fat: a longitudinal population-based twin study.

2009

Exercise is thought to reduce high-risk body fat, but intervention studies are frequently limited by short follow-ups and observational studies by genetic selection. Therefore, we studied the effects of a physically inactive vs active lifestyle on high-risk (visceral, liver and intramuscular) fat in twin pairs discordant for leisure-time physical activity habits for over 30 years.A longitudinal population-based twin study.Sixteen middle-aged (50-74 years) same-sex twin pairs (seven monozygotic (MZ), nine dizygotic (DZ)) with long-term discordance for physical activity habits were comprehensively identified from the Finnish Twin Cohort (TWINACTIVE study). Discordance was initially defined in…

Malemedicine.medical_specialtyEndocrinology Diabetes and MetabolismPopulationLeisure timePhysical activityTwinsMedicine (miscellaneous)030209 endocrinology & metabolismPhysical exerciseIntra-Abdominal FatMotor Activity03 medical and health sciences0302 clinical medicineLeisure ActivitiesWeight lossRisk FactorsInternal medicineSurveys and QuestionnairesmedicineHumans030212 general & internal medicineLongitudinal StudiesObesityeducationFinlandAgededucation.field_of_studyNutrition and Dieteticsbusiness.industryMiddle Agedmedicine.diseaseTwin studyObesityMagnetic Resonance ImagingEndocrinologyFemaleIntramuscular fatmedicine.symptombusinessDemographyInternational journal of obesity (2005)
researchProduct

Concerted actions of insulin-like growth factor 1, testosterone, and estradiol on peripubertal bone growth: a 7-year longitudinal study.

2011

A better understanding of how bone growth is regulated during peripuberty is important for optimizing the attainment of peak bone mass and for the prevention of osteoporosis in later life. In this report we used hierarchical models to evaluate the associations of insulin-like growth factor 1 (IGF-1), estradiol (E(2) ), and testosterone (T) with peripubertal bone growth in a 7-year longitudinal study. Two-hundred and fifty-eight healthy girls were assessed at baseline (mean age 11.2 years) and at 1, 2, 3.5, and 7 years. Serum concentrations of IGF-1, E(2) , and T were determined. Musculoskeletal properties in the left lower leg were measured using peripheral quantitative computed tomography …

Peak bone massAdultMalemedicine.medical_specialtyAdolescentEndocrinology Diabetes and Metabolismmedicine.medical_treatmentOsteoporosisBone and BonesInsulin-like growth factorInternal medicinemedicineHumansOrthopedics and Sports MedicineTestosteroneLongitudinal StudiesQuantitative computed tomographyInsulin-Like Growth Factor IChildTestosteroneBone mineralBone growthLegBone Developmentmedicine.diagnostic_testEstradiolbusiness.industryPubertymedicine.diseaseEndocrinologyMenarcheFemalebusinessFollow-Up StudiesJournal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research
researchProduct

Association of leisure time physical activity and NMR-detected circulating amino acids in peripubertal girls: A 7.5-year longitudinal study

2017

AbstractThis study investigated the longitudinal associations of physical activity and circulating amino acids concentration in peripubertal girls. Three hundred ninety-six Finnish girls participated in the longitudinal study from childhood (mean age 11.2 years) to early adulthood (mean age 18.2 years). Circulating amino acids were assessed by nuclear magnetic resonance spectroscopy. LTPA was assessed by self-administered questionnaire. We found that isoleucine, leucine and tyrosine levels were significantly higher in individuals with lower LTPA than their peers at age 11 (p &lt; 0.05 for all), independent of BMI. In addition, isoleucine and leucine levels increased significantly (~15%) fro…

0301 basic medicineGerontologyLongitudinal studyAdolescentLeisure timelongitudinal researchPhysical activitylcsh:MedicinePhysiologymarkersbiomarkkeritpitkittäistutkimus030204 cardiovascular system & hematologyHealth benefitsaminohapotPaediatric researchphysical activenessArticle03 medical and health sciences0302 clinical medicineLeisure ActivitiesMetabolomicsMedicineHumansLongitudinal StudiesAmino Acidslcsh:ScienceChildExerciseNuclear Magnetic Resonance Biomolecularchemistry.chemical_classificationamino acidsMultidisciplinarybusiness.industrygirlslcsh:RtytötAmino acid030104 developmental biologychemistrymarkkeritEarly adolescentslcsh:QFemaleIsoleucineLeucinebusinessfyysinen aktiivisuus
researchProduct

Comparison of ultrasound and bone mineral density assessment of the calcaneus with different regions of interest in healthy early menopausal women.

1998

This study investigated the effect of different sized regions of interest (ROIs) on quantitative ultrasound (QUS) variables of the calcaneus. The effect on QUS of using a fixed ROI as opposed to an ROI adjusted for foot length was also assessed. Eighty Caucasian women, aged 50-57 yr (mean 53 +/- 2) who were healthy and within 0. 5-5 yr of the onset of menopause participated in this study. Using the QUS-1(trade mark) Ultrasonometer (Metra Biosystems, Mountain View, CA), we assessed broadband ultrasound attenuation ([BUA] and UBI-4, dB/MHz), the average transit time through the heel ([TTH], mus) and a multiple-factor index (UBI-4T = UBI-4/TTH, dB/[MHz. mus]). The QUS measurement results were …

Bone mineralHeelbusiness.industryEndocrinology Diabetes and MetabolismRadiographyUltrasoundTransit timeMiddle AgedPostmenopauseCalcaneusmedicine.anatomical_structureRegion of interestBone DensitymedicinePhoton absorptiometryHumansRadiology Nuclear Medicine and imagingOrthopedics and Sports MedicineFemaleCalcaneusMenopausebusinessNuclear medicineUltrasonographyJournal of clinical densitometry : the official journal of the International Society for Clinical Densitometry
researchProduct

Adipose Tissue Dysfunction and Altered Systemic Amino Acid Metabolism Are Associated with Non-Alcoholic Fatty Liver Disease

2015

Article

MaleMagnetic Resonance Spectroscopymedicine.medical_treatmentBiopsyAdipose tissuelcsh:MedicineFats0302 clinical medicineNon-alcoholic Fatty Liver DiseaseMetabolitesTerveystiede - Health care scienceSkeletal musclesAmino Acidslcsh:ScienceNon-U.S. Gov'tchemistry.chemical_classification0303 health sciencesMultidisciplinaryResearch Support Non-U.S. Gov'tFatty liverFatty AcidsrasvamaksaMiddle Aged3. Good healthAmino acidmedicine.anatomical_structureAdipose TissueLiverFemaleResearch Articlemedicine.medical_specialtyAdipose tissue030209 endocrinology & metabolismamino acid metabolismBiologyResearch Support03 medical and health sciencesInsulin resistanceInternal medicineFatty livermedicineJournal ArticleHumansObesityFatty acids030304 developmental biologyfatty liverCatabolismInsulinta1184lcsh:RFatty acidSkeletal muscleta3121medicine.diseaseEndocrinologychemistrylcsh:QGene expression
researchProduct

Exercise in type 2 diabetes: The mechanisms of resistance and endurance training

2012

This highlight article focuses on the effects of different types of exercise on the prevention and treatment of type 2 diabetes and on future challenges in developing effective preventive strategies. 1.Current prevalence of diabetes in China Cardiovascular diseases have become the leading cause of death in China.Diabetes is a major risk factor for cardiovascular diseases and the rapid change in lifestyle is the main reason for the increased risk for cardiovascular diseases in China.The China

medicine.medical_specialtybusiness.industryPhysical Therapy Sports Therapy and RehabilitationResistance (psychoanalysis)Type 2 diabetesmedicine.diseaseIncreased riskEndurance trainingDiabetes mellitusmedicinePhysical therapyOrthopedics and Sports MedicineRisk factorbusinessIntensive care medicineCause of deathJournal of Sport and Health Science
researchProduct

Comparison of three ultrasonic axial transmission methods for bone assessment.

2005

Abstract This study compared three approaches to bone assessment using ultrasonic axial transmission. In 41 fresh human radii, velocity of the first arriving signal was measured with a commercial device (Sunlight Omnisense ™ ) operating at 1.25 MHz, a prototype based on 1-MHz bidirectional axial transmission and a low-frequency (200 kHz) prototype, also measuring the velocity of a slower wave. Cortical and trabecular bone mineral density, cortical thickness and cross-sectional area were determined by peripheral quantitative computed tomography. Significant but modest correlation between velocities reflects differences in the nature of the propagating waves and methodological differences. Of…

MaleMaterials scienceAcoustics and UltrasonicsBiophysicsSignalBone and BonesBone DensitymedicineCadaverHumansRadiology Nuclear Medicine and imagingUltrasonicsQuantitative computed tomographyAxial transmissionAgedUltrasonographyAged 80 and overRadiological and Ultrasound Technologymedicine.diagnostic_testAnatomyMiddle AgedTrabecular boneRadiusmedicine.anatomical_structureMineral densityCortical boneUltrasonic sensorFemaleBiomedical engineeringUltrasound in medicinebiology
researchProduct

Does hysterectomy with ovarian conservation affect bone metabolism and density?

2002

We evaluated whether hysterectomy with ovarian conservation (HYX) has an effect on bone metabolism and density in 176 healthy Caucasian postmenopausal women aged 48-59 years. Bone properties of the hip, spine, radius, tibia, and calcaneus were measured using different bone assessment modalities. In addition, bone turnover was assessed using serum bone-specific alkaline phosphatase (BAP), osteocalcin (OC), and tartrate-resistant acid phosphatase (TRAP) 5b as biomarkers. Our results showed that women having HYX had a significantly lower level of OC ( P = 0.017) and a marginally lower level of TRAP 5b ( P = 0.051) and higher bone mineral density (BMD) of the femoral neck ( P = 0.037) and lumba…

musculoskeletal diseasesmedicine.medical_specialtyBone densityEndocrinology Diabetes and MetabolismHysterectomyBone and BonesBone remodelingEndocrinologyBone DensityInternal medicineMedicineHumansOrthopedics and Sports MedicineTibiaFemoral neckBone mineralbiologybusiness.industryOvaryGeneral MedicineMiddle Agedmusculoskeletal systemPostmenopausemedicine.anatomical_structureEndocrinologyOsteocalcinbiology.proteinAlkaline phosphataseFemaleCalcaneusFollicle Stimulating HormonebusinessJournal of bone and mineral metabolism
researchProduct

Variability in Lateral Positioning of Surface EMG Electrodes

2009

The positions of EMG electrodes over the knee extensor muscles were examined in 19 healthy men using MR images; electrodes were placed according to the SENIAM (surface electromyography for non-invasive assessment of muscles) guidelines. From axial images, the medial and lateral borders of the muscles were identified, and the arc length of the muscle surface was measured. The electrode location was expressed as a percentage value from the muscle’s medial border. EMGs were recorded during isometric maximal contraction, squat jumps, and countermovement jumps and analyzed for cross-correlation. The results showed that variations in lateral positioning were greatest in vastus medialis (47% SD 11…

AdultMaleMaterials scienceVastus medialisBiophysicsSquatIsometric exerciseElectromyographySensitivity and SpecificityIsometric ContractionmedicineHumansOrthopedics and Sports MedicineMaximal contractionMuscle SkeletalElectrodesmedicine.diagnostic_testElectromyographyRehabilitationLateral positioningReproducibility of ResultsAnatomymusculoskeletal systemElectrode locationElectrodePhysical EnduranceJournal of Applied Biomechanics
researchProduct

Effect of Six-Month Diet Intervention on Sleep among Overweight and Obese Men with Chronic Insomnia Symptoms : A Randomized Controlled Trial

2016

Growing evidence suggests that diet alteration affects sleep, but this has not yet been studied in adults with insomnia symptoms. We aimed to determine the effect of a six-month diet intervention on sleep among overweight and obese (Body mass index, BMI >= 25 kg/m(2)) men with chronic insomnia symptoms. Forty-nine men aged 30-65 years with chronic insomnia symptoms were randomized into diet (n = 28) or control (n = 21) groups. The diet group underwent a six-month individualized diet intervention with three face-to-face counseling sessions and online supervision 1-3 times per week; 300-500 kcal/day less energy intake and optimized nutrient composition were recommended. Controls were instruct…

CounselingMaleobesityTime FactorsINTERNATIONAL CLASSIFICATIONOverweightinsomnia symptomsBody Mass Indexlaw.invention0302 clinical medicineRandomized controlled triallawSleep Initiation and Maintenance DisordersSurveys and QuestionnairesInsomniasleep onset030212 general & internal medicineFinlandPOPULATION2. Zero hungerdiet interventionNutrition and Dieteticsylipainota3141Middle AgedWEIGHT-GAINPREVALENCE3. Good healthTreatment OutcomeBALANCESleep diarymedicine.symptomSleep onsetNutritive Valuelcsh:Nutrition. Foods and food supplyAdultmedicine.medical_specialtyDiet ReducingNutritional Statuslcsh:TX341-641Articleuni (lepotila)DISORDERS ICSD03 medical and health sciencesInternal medicineWeight LossReaction TimemedicineHumansQUALITYNocturiaoverweightsleepAgedCaloric Restrictionbusiness.industrynutrientENERGY-EXPENDITUREinsomnia symptoms; sleep; sleep onset; diet intervention; nutrient; overweight; obesity3141 Health care scienceNutrition AssessmentFATRISK-FACTORSPhysical therapylihavuusSleep onset latencybusinessWeight gain030217 neurology & neurosurgeryFood ScienceNutrients
researchProduct

Effects of calcium, dairy product, and vitamin D supplementation on bone mass accrual and body composition in 10-12-y-old girls: a 2-y randomized tri…

2005

Little is known about the relative effectiveness of calcium supplementation from food or pills with or without vitamin D supplementation for bone mass accrual during the rapid growth period.The purpose was to examine the effects of both food-based and pill supplements of calcium and vitamin D on bone mass and body composition in girls aged 10-12 y.This placebo-controlled intervention trial randomly assigned 195 healthy girls at Tanner stage I-II, aged 10-12 y, with dietary calcium intakes900 mg/d to 1 of 4 groups: calcium (1000 mg) + vitamin D3 (200 IU), calcium (1000 mg), cheese (1000 mg calcium), and placebo. Primary outcomes were bone indexes of the hip, spine, and whole body by dual-ene…

medicine.medical_specialtyMedicine (miscellaneous)chemistry.chemical_elementCalciumBone remodelinglaw.inventionchemistry.chemical_compoundAbsorptiometry PhotonRandomized controlled trialDouble-Blind MethodlawBone DensityCheeseInternal medicinemedicineVitamin D and neurologyHumansVitamin DChildMenarcheAnalysis of VarianceNutrition and DieteticsIntention-to-treat analysisBone DevelopmentBone Density Conservation AgentsTibiabusiness.industryPubertyCalcium DietaryRadiusEndocrinologymedicine.anatomical_structurechemistryPillDietary SupplementsBody CompositionLinear ModelsPatient ComplianceCortical boneFemaleBone RemodelingDairy ProductsbusinessCholecalciferol
researchProduct

Are skeletal muscleFNDC5gene expression and irisin release regulated by exercise and related to health?

2013

Recently, contradictory findings have been reported concerning the function of irisin and its precursor gene, skeletal muscle FNDC5, in energy homeostasis, and the associated regulatory role of exercise and PGC-1α. We therefore evaluated whether muscle FNDC5 mRNA and serum irisin are exercise responsive and whether PGC-1α expression is associated with FNDC5 expression. The male subjects in the study performed single exercises: (1) 1 h low-intensity aerobic exercise (AE) (middle-aged, n = 17), (2) a heavy-intensity resistance exercise (RE) bout (young n = 10, older n = 11) (27 vs. 62 years), (3) long-term 21 weeks endurance exercise (EE) training alone (twice a week, middle-aged, n = 9), or …

medicine.medical_specialtyPhysiologybusiness.industrySkeletal muscleOverweightFNDC5Energy homeostasisEndocrinologyReal-time polymerase chain reactionmedicine.anatomical_structureEndurance trainingInternal medicineGene expressionmedicineAerobic exercisemedicine.symptombusinessThe Journal of Physiology
researchProduct

Effect of aerobic exercise and diet on liver fat in pre-diabetic patients with non-alcoholic-fatty-liver-disease: A randomized controlled trial.

2017

AbstractThe study aimed to assess whether aerobic exercise (AEx) training and a fibre-enriched diet can reduce hepatic fat content (HFC) and increase glycaemic control in pre-diabetic patients with non-alcoholic fatty liver disease (NAFLD). Six-hundred-and-three patients from seven clinics in Yangpu district, Shanghai, China were recruited. Of them 115 individuals aged 50–65-year fulfilled the inclusion criteria (NAFLD with impaired fasting glucose or impaired glucose tolerance) and were randomly assigned into exercise (AEx n = 29), diet (Diet n = 28), exercise plus diet (AED n = 29), or no-intervention (NI n = 29) groups. Progressive supervised AEx training (60–75% VO2max intensity) was gi…

Lifestyle modificationMaleLIFE-STYLE INTERVENTIONSlcsh:MedicineruokavaliotGastroenterologyImpaired glucose tolerance0302 clinical medicineWeight lossNon-alcoholic Fatty Liver DiseaseMedicinelcsh:Science10. No inequalityIN-VIVOAdipositySPECTROSCOPYMultidisciplinaryINSULIN SENSITIVITYdietary fibreFatty liverrasvamaksaMiddle Aged3. Good healthIntention to Treat AnalysisTreatment OutcomeLiverdietsDisease Progression030211 gastroenterology & hepatologyFemaleaerobic trainingmedicine.symptommedicine.medical_specialtyTYPE-2 DIABETES-MELLITUSWEIGHT-LOSS030209 endocrinology & metabolismArticlePrediabetic State03 medical and health sciencesIMPAIRED GLUCOSE-TOLERANCEInsulin resistanceInternal medicineAerobic exerciseHumansHEPATIC STEATOSISExercise physiologyExerciseMETAANALYSISfatty liverGlycated HemoglobinIntention-to-treat analysisHepatologybusiness.industrylcsh:Raerobinen harjoittelumedicine.diseaseImpaired fasting glucoseDietravintokuitulcsh:QNORDIC WALKINGInsulin ResistancebusinessBiomarkersScientific reports
researchProduct

Food consumption and nutrient intakes with a special focus on milk product consumption in early pubertal girls in Central Finland

2005

AbstractObjectiveTo evaluate the current status of dietary intakes in early pubertal girls with a special focus on milk products.DesignCross-sectional data using 3-day food records.SubjectsEight hundred and sixty girls, aged 10–12 years, at Tanner maturation stage I-III.ResultsThe mean consumption of milk products (620 g day−1) was similar to that of a Finnish study in the 1980s, while the consumption of non-milk drinks (403 gday−1) had increased. Twelve per cent of the girls had a dairy-restricted diet and consumed significantly less milk products than girls with a non-restricted diet (465 vs. 644 g day−1, P&lt;0.001). Girls with low milk product consumption had the highest non-milk drinks…

medicine.medical_specialty030309 nutrition & dieteticsNutrition EducationSaturated fatFood consumptionNutritional StatusMedicine (miscellaneous)030209 endocrinology & metabolismDiet SurveysStatistics Nonparametric03 medical and health sciences0302 clinical medicineAnimal scienceNutrientMilk productsInternal medicinemedicineAnimalsHumansVitamin DChildFinland2. Zero hungerConsumption (economics)Analysis of Variance0303 health sciencesNutrition and Dieteticsbusiness.industryPubertyPublic Health Environmental and Occupational HealthVitamin D intakeFeeding BehaviorDietary FatsCalcium DietaryCross-Sectional StudiesMilkEndocrinologyDiet qualityFemaleEnergy IntakebusinessPublic Health Nutrition
researchProduct

Low volumetric BMD is linked to upper-limb fracture in pubertal girls and persists into adulthood: A seven-year cohort study

2009

Abstract The aetiology of increased incidence of fracture during puberty is unclear. This study aimed to determine whether low volumetric bone mineral density (vBMD) in the distal radius is associated with upper-limb fractures in growing girls, and whether any such vBMD deficit persists into adulthood. Fracture history from birth to 20 years was obtained and verified by medical records in 1034 Finnish girls aged 10–13 years. Bone density and geometry at distal radius, biomarkers and lifestyle/behavioural factors were assessed in a subset of 396 girls with a 7.5-year follow-up. We found that fracture incidence peaked during puberty (relative risk 3.1 at age of 8–14 years compared to outside …

Pediatricsmedicine.medical_specialtyHistologyAdolescentBone densityPhysiologyEndocrinology Diabetes and MetabolismCohort StudiesUpper ExtremityFractures BoneBone DensitymedicineHumansChildFinlandBone mineralbusiness.industryIncidence (epidemiology)PubertySurgerymedicine.anatomical_structureEl NiñoRelative riskCohortUpper limbFemalebusinessCohort studyBone
researchProduct

Exercise, the endocannabinoid system and metabolic health

2013

As obesity and associated metabolic disorders, such as type 2 diabetes and dyslipidemia, are becoming one of the most serious health problems worldwide, development of effective therapies is a high priority. In the search for treatments, the recently discovered endocannabinoid system (ECS) has begun to garner attention, and a wealth of research is now focusing on this unique neuromodulatory system named after the plant that led to its discovery. The ECS consists of G protein-coupled cannabinoid receptors (CB1 and CB2), their endogenous lipid-derived ligands (endocannabinoids, N-arachidonoylethanolamine, named anandamide (AEA) and 2-arachidonoylglycerol (2-AG)) and the enzymes for ligand syn…

medicine.medical_specialtyCannabinoid receptorbusiness.industryCalorie restrictionAdipose tissuePhysical Therapy Sports Therapy and RehabilitationType 2 diabetesmedicine.diseaseEndocannabinoid systemInsulin resistanceEndocrinologyInternal medicinemedicinelipids (amino acids peptides and proteins)Orthopedics and Sports MedicineReceptorbusinessDyslipidemiaJournal of Sport and Health Science
researchProduct

Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium

2014

Quantitative ultrasound of the heel captures heel bone properties that independently predict fracture risk and, with bone mineral density (BMD) assessed by X-ray (DXA), may be convenient alternatives for evaluating osteoporosis and fracture risk. We performed a meta-analysis of genome-wide association (GWA) studies to assess the genetic determinants of heel broadband ultrasound attenuation (BUA; n = 14 260), velocity of sound (VOS; n = 15 514) and BMD (n = 4566) in 13 discovery cohorts. Independent replication involved seven cohorts with GWA data (in silico n = 11 452) and new genotyping in 15 cohorts (de novo n = 24 902). In combined random effects, meta-analysis of the discovery and repli…

MaleOncologyHeelBone densityOsteoporosisGenome-wide association studyCohort StudiesFractures Bonequantitative ultrasoundBone DensityGenetics (clinical)riskUltrasonographyAged 80 and overGeneticsmedicine.diagnostic_testAssociation Studies Articlesphenotypesta3141General MedicineMiddle Aged3. Good healthmedicine.anatomical_structureosteoporosis diagnostic radiologic examination roentgen rays ultrasonography bone mineral density fractures calcaneus chromosomes genes genome heel longevity single nucleotide polymorphism sound genetics chromosome 7q31 genotype determination genome-wide association study attenuation osteoporotic fracture risk/dk/atira/pure/sustainabledevelopmentgoals/good_health_and_well_beingFemalewomenAdultmusculoskeletal diseasesmedicine.medical_specialtyx-ray absorptiometrySingle-nucleotide polymorphismdensitometryBiologyPolymorphism Single NucleotidecalcaneusYoung AdultSDG 3 - Good Health and Well-beingInternal medicineGeneticsmedicineHumansGenetic Predisposition to DiseaseMolecular BiologyDual-energy X-ray absorptiometryVLAGAgedGlobal NutritionWereldvoedingta1184ta3121medicine.diseaseosteoporosisCalcaneusGenetic epidemiologyfractureOsteoporosismineral densityCalcaneusGenome-Wide Association Study
researchProduct

Correlation of Tibial Low-Frequency Ultrasound Velocity with Femoral Radiographic Measurements and BMD in Elderly Women

2009

The ultrasonic axial transmission technique has been proposed as a method for cortical bone characterization. Using a low enough center frequency, Lamb modes can be excited in long bones. Lamb waves propagate throughout the cortical bone layer, which makes them appealing for characterizing bone material and geometrical properties. In the present study, a prototype low-frequency quantitative ultrasonic axial transmission device was used on elderly women (n = 132) to investigate the relationships between upper femur geometry and bone mineral density (BMD) and tibial speed of sound. Ultrasonic velocities (V) were recorded using a two-directional measurement set-up on the midtibia and compared …

musculoskeletal diseasesMaterials scienceAcoustics and UltrasonicsBone densityOsteoporosisBiophysicsRisk AssessmentFractures BoneAbsorptiometry PhotonBone DensitymedicineHumansMass ScreeningRadiology Nuclear Medicine and imagingFemurFemurTibiaOsteoporosis PostmenopausalMass screeningAgedUltrasonographyAged 80 and overBone mineralAnthropometryTibiaRadiological and Ultrasound Technologybusiness.industryUltrasoundAnatomymedicine.diseasemedicine.anatomical_structureFemaleCortical bonebusinessNuclear medicineUltrasound in Medicine &amp; Biology
researchProduct

PO-201 Aging attenuates the effect of aerobic capacity in muscle and serum metabolic profile but not in white adipose tissue

2018

Objective Aerobic capacity is a quantitative predictor of the morbidity and mortality in many diverse patient populations. While aging is the main factor affecting aerobic capacity. The present study aimed to assess the effect of aerobic capacity and aging on metabolic profile in rats and to investigate the metabolic interactions between white adipose tissue (WAT), muscle and serum.&#x0D; Methods In this study, we used rat models that were selectively bred to differ in maximal running capacity (High capacity runners (HCR) and Low capacity runners (LCR)). Part of the rats were sacrificed after 9 months and the rest at 21 months. The effect of aerobic capacity on metabolic profile was assesse…

medicine.medical_specialtyChemistrySkeletal muscleLipid metabolismWhite adipose tissueLower bodyMetabolomicsmedicine.anatomical_structureEndocrinologyInternal medicinemedicineComposition (visual arts)human activitiesMetabolic profileAerobic capacityExercise Biochemistry Review
researchProduct

Clinical performance of a highly portable, scanning calcaneal ultrasonometer.

2001

The aim of this study was to establish a normative database, assess precision, and evaluate the ability to identify women with low bone mass and to discriminate women with fracture from those without for a highly portable, scanning calcaneal ultrasonometer: the QUS-2. Fourteen hundred and one Caucasian women were recruited for the study. Among them were 794 healthy women 25–84 years of age evenly distributed per 10-year period to establish a normative database. Of these, 171 aged 25–34 years were defined as the young normal group for the purpose of T-score determination. Precision was assessed within 1 day (short-term) and over a 16-week period (long-term) in 79 women aged 25–84 years. Five…

musculoskeletal diseasesAdultmedicine.medical_specialtyAgingHeelBone densityBone diseaseEndocrinology Diabetes and MetabolismPoint-of-Care SystemsPopulationOsteoporosisFractures BoneBone DensityReference ValuesmedicineHumanseducationFemoral neckAgedUltrasonographyBone mineralAged 80 and overeducation.field_of_studyLumbar Vertebraebusiness.industryFemur NeckReproducibility of ResultsMiddle Agedmedicine.diseaseSurgeryCalcaneusmedicine.anatomical_structureROC CurveOsteoporosisFemaleCalcaneusNuclear medicinebusinessOsteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA
researchProduct

What Makes a 97-Year-Old Man Cycle 5,000 km a Year?

2016

&lt;b&gt;&lt;i&gt;Background:&lt;/i&gt;&lt;/b&gt; The nature versus nurture debate is one of the oldest issues in the study of longevity, health and successful aging. &lt;b&gt;&lt;i&gt;Objective:&lt;/i&gt;&lt;/b&gt; We present a 97-year-old man (I.K.) as an example of the effects of habitual exercise on the aging process. &lt;b&gt;&lt;i&gt;Methods:&lt;/i&gt;&lt;/b&gt; Extensive assessments included medical examinations, interviews, musculoskeletal structure, performance characteristics, cognitive function and gut microbiota composition. &lt;b&gt;&lt;i&gt;Results:&lt;/i&gt;&lt;/b&gt; I.K. suffers from iatrogenic hypogonadism, prostate cancer, hypothyroidism and a history of deep popliteal th…

MaleGerontologylifestyleAgingHealth Statusmedia_common.quotation_subjectLongevityPhysical fitnessNature versus nurtureHabits03 medical and health sciencesInterpersonal relationshipCognitionLife Expectancy0302 clinical medicineHumansMedicineInterpersonal RelationsMedical historyhabitual exerciseExerciseGeriatric AssessmentLife Stylemedia_commonAged 80 and overSuccessful agingcyclebusiness.industryLongevityta3141Cognition030229 sport scienceshealthy agingPhysical FitnessLife expectancysportsGeriatrics and Gerontologybusiness030217 neurology & neurosurgery
researchProduct

Relationship of sex hormones to bone geometric properties and mineral density in early pubertal girls.

2004

This study aimed to evaluate the associations among serum 17beta-estradiol (E2), testosterone (T), sex hormone-binding globulin (SHBG), bone geometric properties, and mineral density in 248 healthy girls between the ages of 10 and 13 yr old. The left tibial shaft was measured by peripheral quantitative computed tomography (Stratec XCT-2000; Stratec Medizintechnik, GmbH, Pforzheim, Germany). The cortical bone and marrow cavity areas were expressed as proportions of the total tibial cross-sectional area (CSA). Cortical thickness and total volumetric bone mineral density (vBMD) were also determined. These tibial geometric and densitometric measures were correlated against the serum sex hormone…

medicine.medical_specialtyBone densityMedullary cavityEndocrinology Diabetes and MetabolismClinical BiochemistryPuberty PrecociousBiochemistryBone remodelingEndocrinologySex hormone-binding globulinAbsorptiometry PhotonBone DensityInternal medicineSex Hormone-Binding GlobulinmedicineHumansTestosteroneTibiaQuantitative computed tomographyChildGonadal Steroid HormonesBone mineralbiologymedicine.diagnostic_testEstradiolTibiabusiness.industryBiochemistry (medical)Endocrinologymedicine.anatomical_structurebiology.proteinCortical boneFemalebusinessTomography X-Ray ComputedThe Journal of clinical endocrinology and metabolism
researchProduct

Additional file 1: of Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Participants characteristics stratified by gender and four weight group. (PDF 129 kb)

body regionsnervous systemfungi
researchProduct

Bidirectional Influence of the COVID-19 Pandemic Lockdowns on Health Behaviors and Quality of Life among Chinese Adults

2020

Background: The coronavirus disease 2019 (COVID-19) pandemic has created challenges that have caused profound changes in health behaviors. This study aimed to explore how COVID-19 is affecting the health-related quality of life (QoL) among Chinese adults. Methods: The data of health-related behaviors and QoL were collected via online surveys from 2289 adults (mean age = 27.8 &plusmn

MaleHealth Toxicology and MutagenesisHealth Behaviorlcsh:Medicinephysical activityelämänlaaturuokavaliotpandemiat0302 clinical medicineQuality of lifeSurveys and Questionnairessedentary behaviorPandemicMedicine030212 general & internal medicineYoung adultSedentary behaviorQuarantineFemaleCoronavirus Infectionsfyysinen aktiivisuusAdulthyvinvointi (terveydellinen)AdolescentCoronavirus disease 2019 (COVID-19)Pneumonia ViralPhysical activityArticleuni (lepotila)BetacoronavirusYoung Adult03 medical and health sciencesAsian PeopleEnvironmental healthHumanssleepExercisePandemicseristys (eristäminen muista)Sleep qualitySARS-CoV-2business.industrypandemiclcsh:RPublic Health Environmental and Occupational HealthChinese adultsCOVID-19CoronavirusterveyskäyttäytyminenQuality of Lifebusinessdiet030217 neurology & neurosurgery
researchProduct

Differences in cardiometabolic risk profiles between Chinese and Finnish older adults with glucose impairment and central obesity.

2022

Abstract Background Obesity and ethnicity play important roles in cardiovascular complications in patients with type 2 diabetes mellitus (T2DM). This study aimed to compare cardiometabolic risk profiles between Chinese and Finnish older adults of central obesity with prediabetes or T2DM. Methods Study subjects were 60–74 years old and originated from two population samples. The Finnish subjects came from the Kuopio Ischemic Heart Disease (KIHD) study (n = 1089), and the Chinese subjects came from the Shanghai High-risk Diabetic Screen (SHiDS) study (n = 818). The KIHD and SHiDS studies used similar questionnaires to determine participants’ baseline characteristics regarding the history of m…

GerontologyBlood GlucoseChinaEndocrinology Diabetes and MetabolismEndocrinology and DiabetesPrediabetic StateEndocrinologyRisk FactorsType 2 diabetes mellitusEthnicitymedicineHumanssuomalaisetObesityFinlandTriglyceridesAgedCardiometabolic riskChinesebusiness.industryFinnishCholesterol HDLriskitekijätMiddle AgedkiinalaisetCardiovascular disease riskmedicine.diseaseObesityGlucoseDiabetes Mellitus Type 2Cardiovascular DiseasesCentral obesityObesity AbdominalEndokrinologi och diabetessydän- ja verisuonitauditlihavuusInsulin Resistancebusinessaikuistyypin diabetesJournal of endocrinological investigation
researchProduct

Measuring guided waves in long bones: Modeling and experiments in free and immersed plates

2005

Guided waves, consistent with the A0 Lamb mode, have previously been observed in bone phantoms and human long bones. Reported velocity measurements relied on line fitting of the observed wave fronts. Such an approach has limited ability to assess dispersion and is affected by interference by other wave modes. For a more robust identification of modes and determination of phase velocities, signal processing techniques using the fast Fourier transform (FFT) were investigated. The limitations of FFT because of spatial resolution were addressed to improve the precision of the measured modes. An inversion scheme was developed for determining the plate thickness from the measured velocity. Experi…

Materials scienceAcoustics and UltrasonicsLine fittingAcousticsFast Fourier transformBiophysicsModels BiologicalBone and BonesImaging phantomsymbols.namesakeOpticsmedicineHumansRadiology Nuclear Medicine and imagingImage resolutionUltrasonographySignal processingFourier AnalysisRadiological and Ultrasound TechnologyPhantoms Imagingbusiness.industrySignal Processing Computer-AssistedAcousticsmedicine.anatomical_structureFourier analysissymbolsGroup velocityCortical bonebusinessUltrasound in Medicine &amp; Biology
researchProduct

Timing of Exercise Affects Glycemic Control in Type 2 Diabetes Patients Treated with Metformin

2018

Objective. The purpose of the study was to examine the acute effects of the timing of exercise on the glycemic control during and after exercise in T2D. Methods. This study included 26 T2D patients (14 women and 12 men) who were treated with metformin. All patients were tested on four occasions: metformin administration alone (Metf), high-intensity interval training (HIIT) performed at 30 minutes (EX30), 60 minutes (EX60), and 90 minutes (EX90) postbreakfast, respectively. Glucose, insulin, and superoxide dismutase (SOD) activity were examined. Results. Glucose decreased significantly after the exercise in EX30, EX60, and EX90. Compared with Metf, the decline in glucose immediately after th…

Blood GlucoseMaleTime Factorsendocrine system diseasesEndocrinology Diabetes and Metabolismmedicine.medical_treatmentmetformiiniajoitus (suunnittelu)Type 2 diabetes030204 cardiovascular system & hematologyHigh-Intensity Interval TrainingGastroenterologylcsh:Diseases of the endocrine glands. Clinical endocrinologyInterval training0302 clinical medicineEndocrinologyInsulinta315type 2 diabetes patientskuntoliikuntata3141Middle Agedtiming of exerciseMetforminFemaleHigh-intensity interval trainingmedicine.drugAdultmedicine.medical_specialtyArticle Subject030209 endocrinology & metabolism03 medical and health sciencesInternal medicineDiabetes mellitusmedicineHumansHypoglycemic AgentsExercise physiologyExerciseGlycemiclcsh:RC648-665business.industrySuperoxide DismutaseInsulinmedicine.diseaseDiabetes Mellitus Type 2verensokeriClinical Studyglycemic controlbusinessmetforminaikuistyypin diabetesJournal of Diabetes Research
researchProduct

Muscle and serum metabolomes are dysregulated in colon-26 tumor-bearing mice despite amelioration of cachexia with activin receptor type 2B ligand bl…

2019

Cancer-associated cachexia reduces survival, which has been attenuated by blocking the activin receptor type 2B (ACVR2B) ligands in mice. The purpose of this study was to unravel the underlying physiology and novel cachexia biomarkers by use of the colon-26 (C26) carcinoma model of cancer cachexia. Male BALB/c mice were subcutaneously inoculated with C26 cancer cells or vehicle control. Tumor-bearing mice were treated with vehicle (C26+PBS) or soluble ACVR2B either before (C26+sACVR/b) or before and after (C26+sACVR/c) tumor formation. Skeletal muscle and serum metabolomics analysis was conducted by gas chromatography-mass spectrometry. Cancer altered various biologically functional groups …

0301 basic medicineMaleCachexiaPhysiologyEndocrinology Diabetes and MetabolismActivin Receptors Type IIlihaksetMyostatinMice0302 clinical medicineAmino Acidsta315Activin Receptor Type-2BbiologyOrganophosphatesRecombinant Proteins3. Good healthmedicine.anatomical_structureribosome030220 oncology & carcinogenesismyostatinColonic NeoplasmsMetabolomesyöpätauditC26Metabolic Networks and Pathwaysmedicine.medical_specialtyPhenylalanineCachexia03 medical and health sciencesribosomitPhysiology (medical)Internal medicineCell Line TumormedicineAnimalsskeletal muscleMuscle SkeletalPI3K/AKT/mTOR pathwaybusiness.industrySkeletal muscleCancermedicine.diseaseta3122BlockadeImmunoglobulin Fc Fragments030104 developmental biologyEndocrinologyProtein Biosynthesisbiology.proteinaineenvaihduntatuotteetPyrimidine NucleotidesproteiinitbusinesslihassurkastumasairaudetACVR2BAmerican journal of physiology. Endocrinology and metabolism
researchProduct

Activity of Thigh Muscles During Static and Dynamic Stances in Stroke Patients: A Pilot Case-Control Study

2014

Impaired postural control is a key characteristic of mobility problems in stroke patients and has great impact on the incidence of falls and on the level of independence in activities of daily living. The role played by the thigh muscles in balance impairment in stroke patients has not been sufficiently investigated. This study investigated the activities of the thigh muscles in stroke patients during standing balance manipulations.Ten stroke patients and 15 healthy subjects performed 5 upright standing tasks on a force platform: normal standing with eyes open, normal standing with eyes closed, feet together, semi-tandem standing, and a dynamic measurement along a predefined route. The post…

Malemedicine.medical_specialtyActivities of daily livingPosturePilot ProjectsIsometric exercisePhysical medicine and rehabilitationHumansMedicineForce platformMuscle StrengthMuscle SkeletalPostural BalanceStrokeAgedBalance (ability)Community and Home CareElectromyographybusiness.industryRehabilitationPosturographyCase-control studyMiddle Agedmedicine.diseaseParesisStrokeThighCase-Control StudiesData Interpretation StatisticalBerg Balance ScalePhysical therapyFemaleNeurology (clinical)businessTopics in Stroke Rehabilitation
researchProduct

Effects of aerobic exercise and diet intervention on glycaemic control and liver fat content in men and women aged 50–65 years with prediabetes and n…

2016

Abstract Background Prediabetes and non-alcoholic fatty liver disease precede development of type 2 diabetes; however, appropriate lifestyle interventions might help to prevent such progression. We aimed to test whether aerobic exercise training and a high-fibre diet can reduce hepatic fat content and increase insulin sensitivity in individuals with prediabetes and non-alcoholic fatty liver disease. Methods We did a randomised controlled trial in seven clinics in Yangpu district, Shanghai, China. We recruited individuals aged 50–65 years with impaired fasting glucose (5·6–6·9 mmol/L) or impaired glucose tolerance (2 h glucose 7·8–11·0 mmol/L) and diagnosed non-alcoholic fatty liver disease.…

medicine.medical_specialtyEndocrinology Diabetes and MetabolismPopulationType 2 diabeteslaw.inventionImpaired glucose tolerance03 medical and health sciences0302 clinical medicineEndocrinologyRandomized controlled triallawInternal medicineInternal MedicinemedicineAerobic exercise030212 general & internal medicinePrediabeteseducationeducation.field_of_studybusiness.industryFatty livermedicine.diseaseImpaired fasting glucosePhysical therapybusiness030217 neurology & neurosurgeryThe Lancet Diabetes &amp; Endocrinology
researchProduct

The impact of Nordic walking on bone properties in postmenopausal women with pre-diabetes and non-alcohol fatty liver disease

2021

This study investigated the impact of Nordic walking on bone properties in postmenopausal women with pre-diabetes and non-alcohol fatty liver disease (NAFLD). A total of 63 eligible women randomly participated in the Nordic walking training (AEx, n = 33), or maintained their daily lifestyle (Con, n = 30) during intervention. Bone mineral content (BMC) and density (BMD) of whole body (WB), total femur (TF), femoral neck (FN), and lumbar spine (L2-4) were assessed by dual-energy X-ray absorptiometry. Serum osteocalcin, pentosidine, receptor activator of nuclear factor kappa-B ligand (RANKL) levels were analyzed by ELISA assay. After an 8.6-month intervention, the AEx group maintained their BM…

naisetHealth Toxicology and MutagenesisEndocrinology Diabetes and Metabolismpostmenopausal womenbiomarkkeritAlcoholDiseases of the musculoskeletal systemWalkingDiseasesauvakävelychemistry.chemical_compound0302 clinical medicineAbsorptiometry PhotonBone DensityNon-alcoholic Fatty Liver DiseaseOrthopedics and Sports Medicine030212 general & internal medicineNordic walkingOsteoporosis PostmenopausalbiologykuntoliikuntaFemur Neckmusculoskeletal neural and ocular physiologyFatty liverRmusculoskeletal systemPostmenopausemedicine.anatomical_structureRANKLPre diabetesOsteocalcinMedicineFemaleikääntyneetmusculoskeletal diseasesmedicine.medical_specialtyluuntiheys030209 endocrinology & metabolismArticlePrediabetic State03 medical and health sciencesbone markersInternal medicinemedicineHumansFemurPentosidineFemoral neckPostmenopausal womenbusiness.industryPublic Health Environmental and Occupational Healthmedicine.diseaseEndocrinologyRC925-935chemistryei-alkoholiperäinen rasvamaksasairausbiology.proteinfatty liver diseasebone mineral densitybusinessaikuistyypin diabetesBone Reports
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of >…

Malemedicine.medical_specialtyChinaAdolescentUniversitiesPhysical fitnessPhysical activityIdeal Body Weight030209 endocrinology & metabolismBody-mass indexBody fat percentageBody compositionBody Mass Index03 medical and health sciencesYoung AdultSkeletal muscle mass0302 clinical medicineEpidemiologymedicineHumans030212 general & internal medicineObesityAssociation (psychology)Muscle SkeletalStudents2. Zero hungerPublic healthbusiness.industryPhysical activity4. Educationlcsh:Public aspects of medicinePublic Health Environmental and Occupational Healthlcsh:RA1-1270Test (assessment)Normal weight obesityPhysical FitnessFemalebusinessBody mass indexDemographyResearch ArticleBMC Public Health
researchProduct

Measurement of EMG activity with textile electrodes embedded into clothing.

2007

Novel textile electrodes that can be embedded into sports clothing to measure averaged rectified electromyography (EMG) have been developed for easy use in field tests and in clinical settings. The purpose of this study was to evaluate the validity, reliability and feasibility of this new product to measure averaged rectified EMG. The validity was tested by comparing the signals from bipolar textile electrodes (42 cm(2)) and traditional bipolar surface electrodes (1.32 cm(2)) during bilateral isometric knee extension exercise with two electrode locations (A: both electrodes located in the same place, B: traditional electrodes placed on the individual muscles according to SENIAM, n=10 person…

AdultMaleMaterials scienceKnee JointPhysiologyAverage rectified valueCoefficient of variationTransducersBiomedical EngineeringBiophysicsMonitoring AmbulatoryIsometric exerciseElectromyographySports MedicineSignalSensitivity and SpecificityClothingPhysiology (medical)Isometric ContractionmedicineHumansTreadmillElectrodesExerciseSimulationAnalysis of Variancemedicine.diagnostic_testElectromyographyTextilesReproducibility of ResultsRepeatabilityEquipment DesignMiddle AgedEquipment Failure AnalysisTorqueElectrodeFemaleBiomedical engineeringPhysiological measurement
researchProduct

Familial resemblance and diversity in bone mass and strength in the population are established during the first year of postnatal life

2010

Familial resemblance and diversity in bone structure and strength in adulthood are determined in part during growth. Whether these characteristics are established during gestation or shortly after birth is not known. Total-body, lumbar spine, and femoral neck size and mass and indices of tibial bending strength and distal radial compressive strength were measured using bone densitometry and quantitative computed tomography in 236 girls at 18.5 years of age. Among them, 219, 141, and 105 girls had crown-heel length (CHL) and weight recorded at birth and at 6 and 12 months of age, and then height and weight were recorded at 3, 5, 10, 13, and 15 years of age in 181, 176, 127, 111, and 228 girl…

medicine.medical_specialtyAdolescentBone densityEndocrinology Diabetes and MetabolismPopulationPhysiologyGrowthBiologyBone and BonesBone DensityInternal medicinemedicineHumansFamilyOrthopedics and Sports MedicineQuantitative computed tomographyeducationFemoral neckeducation.field_of_studymedicine.diagnostic_testInfant NewbornInfantmedicine.anatomical_structureEndocrinologyQuartileGestationFemaleDensitometryBone massJournal of Bone and Mineral Research
researchProduct

Atomic layer deposition and characterization of biocompatible hydroxyapatite thin films

2009

Abstract Atomic layer deposition (ALD) was used to produce hydroxyapatite from Ca(thd) 2 (thd = 2,2,6,6-tetramethyl-3,5-heptanedionato) and (CH 3 O) 3 PO onto Si(100) and Corning (0211). Film crystallinity, stoichiometry, possible impurities and surface morphology were determined. The as-deposited films contained significant amounts of carbonate impurities however, annealing at moist N 2 flow reduced the carbonate content even at 400 °C. The as-deposited Ca–P–O films were amorphous but rapid thermal annealing promoted the formation of the hydroxyapatite phase. Mouse MC 3T3-E1 cells were used for the cell culture experiments. According to the bioactivity studies cell proliferation was enhanc…

Materials scienceAnnealing (metallurgy)Borosilicate glassMetals and AlloysMineralogySurfaces and InterfacesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsAmorphous solidchemistry.chemical_compoundAtomic layer depositionCrystallinitychemistryChemical engineeringImpurityMaterials ChemistryPolystyreneThin film
researchProduct

Effect of time-of-day-specific strength training on muscular hypertrophy in men.

2009

The purpose of the present study was to examine effects of time-of-day-specific strength training on muscle hypertrophy and maximal strength in men. A training group underwent a 10-week preparatory training (wk 0-wk 10) scheduled between 17:00 and 19:00 hours. Thereafter, the subjects were randomized either to a morning or afternoon training group. They continued with a 10-week time-of-day-specific training (wk 11-wk 20) with training times between 07:00 and 09:00 hours and 17:00 and 19:00 hours in the morning group and afternoon groups, respectively. A control group did not train but was tested at all occasions. Quadriceps femoris (QF) cross-sectional areas (CSA) and volume were obtained b…

AdultMalemedicine.medical_specialtyTime FactorsStrength trainingPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseMuscle hypertrophyIsometric ContractionMedicinePlethysmographHumansOrthopedics and Sports MedicineKneeCircadian rhythmMuscle StrengthMuscle SkeletalMorningAnalysis of Variancebusiness.industryTraining (meteorology)Resistance TrainingGeneral MedicineHypertrophyAdaptation PhysiologicalMagnetic Resonance ImagingCircadian RhythmPlethysmographyTorqueAnesthesiaPhysical therapyLinear ModelsAnalysis of variancebusinessJournal of strength and conditioning research
researchProduct

Long-term Leisure-time Physical Activity and Serum Metabolome

2013

Background— Long-term physical inactivity seems to cause many health problems. We studied whether persistent physical activity compared with inactivity has a global effect on serum metabolome toward reduced cardiometabolic disease risk. Methods and Results— Sixteen same-sex twin pairs (mean age, 60 years) were selected from a cohort of twin pairs on the basis of their &gt;30-year discordance for physical activity. Persistently (≥5 years) active and inactive groups in 3 population-based cohorts (mean ages, 31–52 years) were also studied (1037 age- and sex-matched pairs). Serum metabolome was quantified by nuclear magnetic resonance spectroscopy. We used permutation analysis to estimate the …

AdultBlood GlucoseMalemedicine.medical_specialtyMultivariate statisticsAdolescentLipoproteinsPopulationPhysiologyPhysical exerciseMotor Activity030204 cardiovascular system & hematologyCohort StudiesYoung Adult03 medical and health sciencesLeisure Activities0302 clinical medicineBlood serumPhysiology (medical)Internal medicineTwins DizygoticmedicineMetabolomeHumansIsoleucineta315education030304 developmental biology2. Zero hunger0303 health scienceseducation.field_of_studybusiness.industryFatty Acidsta3141Twins Monozygoticta3121Middle AgedTwin studyEndocrinologyCohortMetabolomeFemaleCardiology and Cardiovascular MedicinebusinessCohort studyCirculation
researchProduct

Exercise and Metformin Intervention Prevents Lipotoxicity-Induced Hepatocyte Apoptosis by Alleviating Oxidative and ER Stress and Activating the AMPK…

2022

Objective. Nonalcoholic fatty liver disease (NAFLD) and type 2 diabetes (T2DM) commonly coexist and act synergistically to drive adverse clinical outcomes. This study is aimed at investigating the effects of exercise intervention and oral hypoglycaemic drug of metformin (MET) alone or combined on hepatic lipid accumulation. To investigate if oxidative stress and endoplasmic reticulum stress (ERS) are involved in lipotoxicity-induced hepatocyte apoptosis in diabetic mice and whether exercise and/or MET alleviated oxidative stress or ERS-apoptosis by AMPK-Nrf2-HO-1 signaling pathway. Methods. Forty db/db mice with diabetes ( random   blood   glucose ≥ 250   mg / dL ) were randomly allocated i…

Blood GlucoseAgingArticle SubjectNF-E2-Related Factor 2metformiiniApoptosisAMP-Activated Protein KinasesBiochemistryAntioxidantsDiabetes Mellitus ExperimentalMiceohjelmoitunut solukuolemaSuperoxide Dismutase-1aineenvaihduntahäiriötAnimalsHypoglycemic AgentsHematoxylinoksidatiivinen stressibcl-2-Associated X ProteinCaspase 3Cell BiologyGeneral MedicineEndoplasmic Reticulum StressLipidsMetforminOxidative StressDiabetes Mellitus Type 2ei-alkoholiperäinen rasvamaksasairausHepatocyteslääkehoitoEosine Yellowish-(YS)koe-eläinmallitaikuistyypin diabetesSignal TransductionliikuntahoitoOxidative Medicine and Cellular Longevity
researchProduct

Changes in Fat Oxidation and Body Composition after Combined Exercise Intervention in Sedentary Obese Chinese Adults.

2022

(1) Background: Evidence suggests that aerobic exercise and high-intensity interval training (HIIT) might increase fat oxidation and reduce fat. However, limited research has examined the effects of combining progressive aerobic exercise and HIIT interventions in sedentary adults with overweight and obesity, and differences in its effects between men and women remain unclear. The purpose of this study was to investigate the effects of combined progressive aerobic exercise and HIIT (CAEH) on fat oxidation and fat reduction in sedentary Chinese adults and compare sex differences in sedentary adults after seven weeks. (2) Methods: Eighty-four sedentary obese adults were enrolled and allocated …

obesity; exercise; fat loss; fat oxidation at rest; maximal fat oxidationobesityexercisefat oxidation at restrasvakudoksethapettuminenlihavuusGeneral Medicineliikuntaintervalliharjoittelufat lossmaximal fat oxidationpainonhallintaJournal of clinical medicine
researchProduct

Does Systemic Low-Grade Inflammation Associate With Fat Accumulation and Distribution? A 7-Year Follow-Up Study With Peripubertal Girls

2014

Knowledge about the interrelationship between adiposity and systemic low-grade inflammation during pubertal growth is important in detecting early signs of obesity-related metabolic disorders.The objective of the study was to evaluate the developmental trajectories of fat mass (FM) and high sensitive C-reactive protein (hsCRP) levels and factors that could explain the relationship between FM and hsCRP in girls from prepuberty to early adulthood.This was a 7.5-year longitudinal study.The study was conducted at the University of Jyväskylä Sports and Health Science laboratory.Three hundred ninety-six healthy Finnish girls aged 11.2 ± 0.8 years participated in the study.Body composition was ass…

medicine.medical_specialtyLongitudinal studyAdolescentEndocrinology Diabetes and MetabolismClinical BiochemistryAdipokine030209 endocrinology & metabolismContext (language use)Biochemistry03 medical and health sciences0302 clinical medicineEndocrinologyInternal medicinePrepubertymedicineBody Fat DistributionHumansObesity030212 general & internal medicineChildFinlandInflammationAdiponectinbusiness.industryLeptinPubertyBiochemistry (medical)Lipid Metabolismmedicine.diseaseObesityC-Reactive ProteinEndocrinologyAdipose TissueMenarcheFemalebusinessFollow-Up StudiesThe Journal of Clinical Endocrinology &amp; Metabolism
researchProduct

Power training and postmenopausal hormone therapy affect transcriptional control of specific co-regulated gene clusters in skeletal muscle

2010

At the moment, there is no clear molecular explanation for the steeper decline in muscle performance after menopause or the mechanisms of counteractive treatments. The goal of this genome-wide study was to identify the genes and gene clusters through which power training (PT) comprising jumping activities or estrogen containing hormone replacement therapy (HRT) may affect skeletal muscle properties after menopause. We used musculus vastus lateralis samples from early stage postmenopausal (50–57 years old) women participating in a yearlong randomized double-blind placebo-controlled trial with PT and HRT interventions. Using microarray platform with over 24,000 probes, we identified 665 diffe…

AgingCandidate geneTranscription GeneticvaihdevuodetmenopaussiBioinformaticsEstrogen deprivation0302 clinical medicineGene expressionestrogenTranscriptional regulation0303 health sciencesEstrogen Replacement TherapyGeneral MedicineMiddle AgedestrogeeniPostmenopausemedicine.anatomical_structureFemalevoimaharjoitteluMenopausemedicine.symptomTranscriptome-wide studymedicine.medical_specialtyPlyometric trainingmedicine.drug_classBiologyArticletranskriptomin laajuuinen tutkimus03 medical and health sciencesplyometrinen harjoitteluInternal medicinemedicineHumansSkeletal muscle characteristicsKEGGMuscle SkeletalExerciseGene030304 developmental biologyhormonikorvaushoitoSkeletal muscleMuscle weaknessdeprivaatioPower trainingAgeingEndocrinologyluurankolihaksetHormone replacement therapyEstrogenGeriatrics and Gerontology030217 neurology & neurosurgeryAGE
researchProduct

Elastic wave propagation in bone in vivo: methodology.

1995

The purpose of this study was to investigate the usefulness of elastic wave propagation (EWP) in estimating the mechanical properties (elasticity) of human tibia. The test group was composed of 78-yr-old women assigned to high (n = 19) and low (n = 17) bone mineral density (BMD) groups as measured at the calcaneus by the 125I-photon absorption method. The EWP apparatus consisted of an impact-producing hammer with a force strain gauge and two accelerometers positioned on the bone. Results for nylon and acrylic were used to calibrate the apparatus. Polyvinyl chloride (PVC) solid rods and tubes of various diameters were used to evaluate the relationship between the elastic wave velocity and cr…

Materials scienceBone densityAccelerationTransducersBiomedical EngineeringBiophysicsAcrylic ResinsSecond moment of areaMineralogylaw.inventionFractures BonelawBone DensityAnimalsHumansOrthopedics and Sports MedicineHammerComposite materialElasticity (economics)Polyvinyl ChlorideStrain gaugeAgedBone mineralTibiaRehabilitationElasticityNylonsCalibrationCattleFemaleTomographyCalcaneusStress MechanicalTomography X-Ray ComputedAlgorithmsJournal of biomechanics
researchProduct

The COMT val158met Polymorphism Is Associated with Early Pubertal Development, Height and Cortical Bone Mass in Girls

2005

Estrogens are involved in accretion of bone mass during puberty. Catechol-O-Methyltransferase (COMT) is involved in the degradation of estrogens. In this cross-sectional study we investigated associations between the COMT val158met polymorphism, which results in a 60-75% difference in enzyme activity between the val (high activity = H) and the met (low activity = L) variant, and skeletal phenotypes in 246 healthy pre/early pubertal girls. Girls with COMT(LL) were 5.4 cm taller than COMT(HH) girls. Dual x-ray absorptiometry showed higher values of bone mineral content (BMC), and larger areas of total body, femur and spine in COMT(LL). Cortical BMC, measured by peripheral quantitative compute…

medicine.medical_specialtyGenotypeBone densitymedicine.medical_treatmentCatechol O-Methyltransferasebehavioral disciplines and activitiesBone and BonesInsulin-like growth factorAbsorptiometry PhotonMethionineBone DensityInternal medicinemental disordersGenotypemedicineHumansFemurTibiaChildBone mineralPolymorphism GeneticCatechol-O-methyl transferaseEstradiolbusiness.industryPubertyfungiEstrogensValineBody HeightPhenotypemedicine.anatomical_structureEndocrinologynervous systemPediatrics Perinatology and Child HealthBody CompositionRegression AnalysisFemaleCortical boneTomography X-Ray ComputedbusinessPediatric Research
researchProduct

Association Between Exercise and Pubertal BMD Is Modulated by Estrogen Receptor α Genotype

2003

Genetic and environmental factors contribute to bone mass, but the ways they interact remain poorly understood. This study of 245 pre- and early pubertal girls found that the PvuII polymorphism in the ER- gene modulates the effect of exercise on BMD at loaded bone sites. Introduction: Impaired achievement of bone mass at puberty is an important risk factor for the development of osteoporosis in later life. Genetic, as well as environmental, factors contribute to bone mass, but the ways they interact with each other remain poorly understood. Materials and Methods: We investigated the interaction between a PvuII polymorphism at the ER- gene and physical activity (PA) on the modulation of bone…

Heterozygotemedicine.medical_specialtyAdolescentGenotypemedicine.drug_classEndocrinology Diabetes and MetabolismOsteoporosisEstrogen receptorSingle-nucleotide polymorphismPhysical exerciseBiologyBone and BonesBody Mass IndexRisk FactorsInternal medicineGenotypemedicineBody SizeHumansOrthopedics and Sports MedicineChildDeoxyribonucleases Type II Site-SpecificExercisePolymorphism GeneticHomozygotePubertyEstrogen Receptor alphaHeterozygote advantagemedicine.diseaseEndocrinologyEstrogenBody CompositionFemaleBody mass indexJournal of Bone and Mineral Research
researchProduct

Mechanical behavior of the quadriceps femoris muscle tendon unit during low-load contractions

2008

We examined the relationships between morphology and muscle-tendon dynamics of the quadriceps femoris muscle of 11 men using velocity-encoded phase-contrast magnetic resonance imaging (MRI). Thigh muscle electromyography and joint range of motion were first measured outside the MRI scanner during knee extension-flexion tasks that were performed at a rate of 40 times/min with elastic bands providing peak resistance of 5.2 kp (SD 0.4) to the extension. The same movement was repeated inside the MRI scanner bore where tissue velocities and muscle morphology were recorded. The average displacement in the proximal and distal halves of the rectus femoris and vastus intermedius aponeuroses was dif…

AdultMalePhysiologyStrain (injury)ThighTendonsPhysiology (medical)medicineHumansLow loadKneeAponeurosisMuscle SkeletalLegmedicine.diagnostic_testElectromyographybusiness.industryMagnetic resonance imagingAnatomymedicine.diseaseMagnetic Resonance ImagingQuadriceps femoris muscleBiomechanical PhenomenaTendonmedicine.anatomical_structureThighmedicine.symptombusinessMuscle ContractionMuscle contractionJournal of Applied Physiology
researchProduct

Long Term Leisure Time Physical Activity Has a Positive Effect on Bone Mass Gain in Girls

2009

The purpose of this 7-year prospective longitudinal study was to examine whether the level and consistency of leisure-time physical activity (LTPA) during adolescence affected the bone mineral content (BMC) and bone mineral density (BMD) attained at early adulthood. The study subjects were 202 Finnish girls who were 10 to 13 years of age at baseline. Bone area (BA), BMC, and BMD of the total body (TB), total femur (TF), and lumbar spine (L2–L4) were assessed by dual-energy X-ray absorptiometry (DXA). Scores of LTPA were obtained by questionnaire. Girls were divided into four groups: consistently low physical activity (GLL), consistently high (GHH), and changed from low to high (GLH) and fro…

musculoskeletal diseasesmedicine.medical_specialtyLongitudinal studyAdolescentEndocrinology Diabetes and MetabolismLeisure timePhysical activityPhysiologyPhysical exerciseMotor ActivityBone and BonesAbsorptiometry PhotonLeisure ActivitiesBone DensitymedicineHumansOrthopedics and Sports MedicineFemurProspective StudiesChildUltrasonographyBone mineralbusiness.industrymusculoskeletal systemCalcaneusPhysical therapyFemaleLumbar spinebusinessBone massJournal of Bone and Mineral Research
researchProduct

Effect of long-term leisure time physical activity on lean mass and fat mass in girls during adolescence.

2011

The purpose of this 7-yr prospective longitudinal study was to examine if the level and consistency of leisure-time physical activity (LTPA) during adolescence affected the quantity and distribution of lean mass (LM) and fat mass (FM) at early adulthood. The study subjects were 202 Finnish girls who were 10–13 yr old at baseline. LM and FM of the total body (TB), arms, legs, and trunk were assessed by dual-energy X-ray absorptiometry. Muscle cross-sectional area (mCSA) of the left leg was assessed by peripheral quantitative computed tomography. Scores of LTPA were obtained by questionnaire. Girls were divided into four groups comprising those with consistently low (GLL) or consistently hig…

Gerontologymedicine.medical_specialtyLongitudinal studyAgingAdolescentPhysiologyLeisure timePhysical activityPhysical exerciseMotor ActivityMuscle massFat massLeisure ActivitiesPhysiology (medical)Internal medicinemedicineHumansLongitudinal StudiesChildBody WeightTerm (time)EndocrinologyAdipose TissueLean body massBody CompositionFemalePsychologyJournal of applied physiology (Bethesda, Md. : 1985)
researchProduct

OR-039 Normal-weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Objective The primary aim of this study was to examine the associations of normal weight obesity with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass.&#x0D; Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by a bio-impedance device (InBody 720). NWO was defined by a BMI of 18.5 - 23.9 kg/m2 and a body fat percentage of …

Normal weight obesitybusiness.industryBody heightLeisure timePhysical fitnessPhysiologyMedicineHealth riskbusinessFemale studentsBody fat percentageShuttle run testExercise Biochemistry Review
researchProduct

Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture

2012

Bone mineral density (BMD) is the most widely used predictor of fracture risk. We performed the largest meta-analysis to date on lumbar spine and femoral neck BMD, including 17 genome-wide association studies and 32,961 individuals of European and east Asian ancestry. We tested the top BMD-associated markers for replication in 50,933 independent subjects and for association with risk of low-trauma fracture in 31,016 individuals with a history of fracture (cases) and 102,444 controls. We identified 56 loci (32 new) associated with BMD at genome-wide significance (P &lt; 5 × 10 -8). Several of these factors cluster within the RANK-RANKL-OPG, mesenchymal stem cell differentiation, endochondral…

MaleBone densityOsteoporosisGenome-wide association studyMitochondrial Membrane Transport ProteinsBone densitometryFractures Bone0302 clinical medicineBone DensityRisk FactorsFemurGeneticsBone mineral0303 health scienceseducation.field_of_studyExtracellular Matrix ProteinsLumbar VertebraeFemur Neckta3141medicine.anatomical_structureLow Density Lipoprotein Receptor-Related Protein-5/dk/atira/pure/sustainabledevelopmentgoals/good_health_and_well_beingIntercellular Signaling Peptides and ProteinsFemaleGensmusculoskeletal diseases/dk/atira/pure/subjectarea/asjc/1300/1311GenotypePopulationEuropean Continental Ancestry GroupQuantitative Trait Loci030209 endocrinology & metabolismVèrtebres lumbarsBiologyFèmurPolymorphism Single NucleotideArticleWhite People03 medical and health sciencesSDG 3 - Good Health and Well-beingDensitometria òssiaGeneticsmedicineHumansGenetic Predisposition to Diseaseeducation030304 developmental biologyFemoral neckGenetic associationGlycoproteinsGene Expression ProfilingComputational BiologySpectrinta3121medicine.diseasePhosphoproteinsGenesOsteoporosisMesenchymal stem cell differentiationHuman medicineFracturesGenome-Wide Association Study
researchProduct

Is Structured Exercise Performed with Supplemental Oxygen a Promising Method of Personalized Medicine in the Therapy of Chronic Diseases?

2020

Aim: This systematic review aimed to explore the literature to identify in which types of chronic diseases exercise with supplemental oxygen has previously been utilized and whether this type of personalized therapy leads to superior effects in physical fitness and well-being. Methods: Databases (PubMed/MEDLINE, CINHAL, EMBASE, Web of knowledge and Cochrane Library) were searched in accordance with PRISMA. Eligibility criteria included adult patients diagnosed with any type of chronic diseases engaging in supervised exercise training with supplemental oxygen compared to normoxia. A random-effects model was used to pool effect sizes by standardized mean differences (SMD). Results: Out of the…

medicine.medical_specialtySupplemental oxygenmedicine.medical_treatmentPhysical fitnessMEDLINEMedicine (miscellaneous)lcsh:Medicineoxygen therapyCochrane LibraryArticleindividualized exercise prescriptionCoronary artery disease03 medical and health sciences0302 clinical medicineOxygen therapyMedicine030212 general & internal medicineFiO2krooniset tauditexercise medicinesystemaattiset kirjallisuuskatsauksetindividualized exercise prescription FiO2individualized exercise prescription FiO<sub>2</sub>happihoitoCOPDkuntoliikuntabusiness.industryclinical exercise sciencelcsh:Rclinical exercise science; exercise medicine; hyperoxia; individualized exercise prescription FiO2; oxygen therapymedicine.disease030228 respiratory systemPhysical therapyhyperoxiaPersonalized medicinebusinessliikuntahoitoJournal of Personalized Medicine
researchProduct

The effect of hormone replacement therapy and/or exercise on skeletal muscle attenuation in postmenopausal women: a yearlong intervention

2005

Hormone replacement therapy (HRT) has been reported to exert a positive effect on preserving muscle strength following the menopause, however, the mechanism of action remains unclear. We examined whether the mechanism involved preservation of muscle composition as determined by skeletal muscle attenuation. Eighty women aged 50-57 years were randomly assigned to either: HRT, exercise (Ex), HRT + exercise (ExHRT), and control (Co) for 1 year. The study was double-blinded with subjects receiving oestradiol and norethisterone acetate (Kliogest) or placebo. Exercise included progressive high-impact training for the lower limbs. Skeletal muscle attenuation in Hounsfield units (HU) was determined …

medicine.medical_specialtyPhysiologymedia_common.quotation_subjectAdipose tissuePhysical exerciseVertical jumpDouble-Blind MethodPhysiology (medical)Internal medicinemedicineHormone replacement therapy (male-to-female)Body SizeHumansMuscle SkeletalExerciseMenstrual cyclemedia_commonAnalysis of Variancebusiness.industryBody WeightEstrogen Replacement TherapySkeletal muscleGeneral MedicineMiddle Agedmedicine.diseaseNorethisterone acetatePostmenopauseMenopauseEndocrinologymedicine.anatomical_structureAdipose TissueFemaleTomography X-Ray Computedbusinessmedicine.drugClinical Physiology and Functional Imaging
researchProduct

Does sex hormone-binding globulin cause insulin resistance during pubertal growth?

2019

Background The directional influences between serum sex hormone-binding globulin (SHBG), adiposity and insulin resistance during pubertal growth remain unclear. The aim of this study was to investigate bidirectional associations between SHBG and insulin resistance (HOMA-IR) and adiposity from childhood to early adulthood. Methods Participants were 396 healthy girls measured at baseline (age 11.2 years) and at 1, 2, 4 and 7.5 years. Serum concentrations of estradiol, testosterone and SHBG were determined by ELISA, glucose and insulin by enzymatic photometry, insulin-like growth factor 1 (IGF-1) by time-resolved fluoroimmunoassays, whole-body fat mass by dual-energy X-ray absorptiometry and …

0301 basic medicinemedicine.medical_specialtypubertyGlobulinEndocrinology Diabetes and Metabolismmedicine.medical_treatment030209 endocrinology & metabolismlcsh:Diseases of the endocrine glands. Clinical endocrinology03 medical and health sciences0302 clinical medicineEndocrinologyInsulin resistanceSex hormone-binding globulinInternal medicineinsulin resistanceInternal Medicinemedicinesex hormone-binding globulinkehonkoostumussukupuolihormonitadipositylcsh:RC648-665biologybusiness.industryResearchInsulinmenarcheConfoundinginsuliiniresistenssimurrosikämedicine.diseasetytöt030104 developmental biologyEndocrinologyglobuliinitHomeostatic model assessmentMenarchebiology.proteinbusinesshormones hormone substitutes and hormone antagonistsEarly pubertyEndocrine Connections
researchProduct

Serum metabolic profiles in overweight and obese women with and without metabolic syndrome.

2014

Objective: To identify serum biomarkers through metabolomics approach that distinguishes physically inactive overweight/obese women with metabolic syndrome from those who are metabolically healthy, independent of body weight and fat mass. Methods: We applied nuclear magnetic resonance spectroscopy-based profiling of fasting serum samples to examine the metabolic differences between 78 previously physically inactive, body weight and fat mass matched overweight/obese premenopausal women with and without MetS. MetS was defined as the presence of at least three of the following five criteria: waist circumference ≥ 88 cm, serum triacylglycerol ≥ 1.7 mmol/L, and high density lipoprotein cholester…

naisetbusiness.industryEndocrinology Diabetes and MetabolismResearchMEDLINEOverweightmedicine.diseaseBioinformaticsBody weightmetabolomicsObesityMetabolic syndromeFat massMetabolomicsDiabetes mellitusmedicineInternal MedicinelihavuusMetabolomicsWomenObesityMetabolic syndromemedicine.symptombusinessmetabolinen oireyhtymäDiabetologymetabolic syndrome
researchProduct

Assessment of sleep disturbances with the athlete sleep screening questionnaire in Chinese athletes.

2021

This study investigated the factors that are associated with sleep disturbances among Chinese athletes. Sleep quality and associated factors were assessed by the Athlete Sleep Screening Questionnaire (ASSQ, n ​= ​394, aged 18–32 years, 47.6% female). Sleep difficulty score (SDS) and level of sleep problem (none, mild, moderate, or severe) were used to classify participants' sleep quality. Categorical variables were analyzed by Chi-square or fisher's exact tests. An ordinal logistic regression analysis was used to explore factors with poor sleep (SDS ≥8). Approximately 14.2% of participants had moderate to severe sleep problem (SDS ≥8). Fifty-nine percent of the athletes reported sleep distu…

questionnairekyselytutkimusPhysical Therapy Sports Therapy and RehabilitationOrthopedics and Sports Medicineathletesleep qualitysleep healthuni (lepotila)unihäiriöturheilijatSports medicine and health science
researchProduct

Influence of long-term postmenopausal hormone-replacement therapy on estimated structural bone strength: A study in discordant monozygotic twins

2010

Although postmenopausal hormone-replacement therapy (HRT) is known to prevent fractures, knowledge on the influence of long-term HRT on bone strength and its determinants other than areal bone mineral density is scarce. This study used a genetically controlled design with 24 monozygotic female twin pairs aged 54 to 72 years in which one cotwin was using HRT (mean duration 8 years) and the other had never used HRT. Estimated bone strength, cross-sectional area, volumetric bone mineral density, bone mineral mass, and cross-sectional density and mass distributions were assessed in the tibial shaft, distal tibia, and distal radius with peripheral computed tomography (pQCT). In the tibial shaft,…

medicine.medical_specialtyTime FactorsEndocrinology Diabetes and Metabolismmedicine.medical_treatmentDentistryMonozygotic twin030209 endocrinology & metabolismBone and Bones03 medical and health sciences0302 clinical medicineBone strengthBone DensitymedicineHumansPostmenopausal Hormone Replacement TherapyOrthopedics and Sports Medicineta315Aged030304 developmental biologyBone mineral0303 health sciencesPostmenopausal womenAnthropometrybusiness.industryEstrogen Replacement Therapyta3141Hormone replacement therapy (menopause)Organ SizeTwins Monozygoticta3142Middle AgedHormonesConfidence intervalSurgerymedicine.anatomical_structureBody CompositionFemaleCortical boneDiaphysesSelf ReportbusinessJournal of Bone and Mineral Research
researchProduct

Comparison of heart rate monitoring with indirect calorimetry for energy expenditure evaluation

2012

Abstract Purpose The purpose of this study was to compare established methods with newly-developed methods for estimating the total energy expenditure (TEE). Methods The study subjects comprised 46 individuals, including 16 middle-aged men (mean age 51.4 years), 14 middle-aged women (mean age 49.9 years) and 16 young women (mean age 19.1 years). The TEE was estimated from 24-h heart rate (HR) data using newly-developed software (MoveSense HRAnalyzer 2011a, RC1, Suunto Oy, Vantaa, Finland), and was compared against the TEE determined using doubly labeled water (DLW). Agreement between the two methods was analyzed using Bland and Altman plots. Results The HR method yielded similar TEE values …

Doubly labeled waterbusiness.industryHeart rate monitoringPhysical Therapy Sports Therapy and RehabilitationMean ageDoubly labeled waterta3141Mean differenceTotal energy expenditureEnergy expenditureMales and femalesHeart rate monitoringHeart rateMedicineTotal energy expenditureOrthopedics and Sports Medicinebusinesshuman activitiesGroup levelDemographyJournal of Sport and Health Science
researchProduct

Associations of disordered sleep with body fat distribution, physical activity and diet among overweight middle-aged men

2015

This cross-sectional study aimed to investigate whether body fat distribution, physical activity levels and dietary intakes are associated with insomnia and/or obstructive sleep apnea among overweight middle-aged men. Participants were 211 Finnish men aged 30-65 years. Among the 163 overweight or obese participants, 40 had insomnia only, 23 had obstructive sleep apnea only, 24 had comorbid insomnia and obstructive sleep apnea and 76 were without sleep disorder. The remaining 48 participants had normal weight without sleep disorder. Fat mass, levels of physical activity and diet were assessed by dual-energy X-ray densitometry, physical activity questionnaire and 3-day food diary, respectivel…

AdultMalemedicine.medical_specialtyinsomniaCognitive Neurosciencephysical activityComorbidityMotor ActivityOverweightBody Mass IndexOSABehavioral NeuroscienceFolic AcidSleep Initiation and Maintenance DisordersSurveys and QuestionnairesInternal medicinemedicineInsomniaBody Fat DistributionHumansObesityExerciseFinlandAdiposityAgedSleep Apnea ObstructiveSleep disorderbusiness.industrySleep apneaApneata3141dietary intakesFeeding BehaviorGeneral MedicineMiddle AgedOverweightmedicine.diseaseDietary FatsObesityDietObstructive sleep apneaCross-Sectional Studiesfat distributionObesity AbdominalPhysical therapymedicine.symptombusinessBody mass indexJournal of Sleep Research
researchProduct

The associations of serum serotonin with bone traits are age- and gender-specific

2014

Context Serotonin plays a potential role in bone metabolism, but the nature and extent of this relationship is unclear and human studies directly addressing the skeletal effect of circulating serotonin are rare. Objective The study aimed to investigate the associations between serum serotonin and bone traits at multiple skeletal sites in women and men. Subjects and Methods Subjects were part of the CALEX-family study and comprised 235 young women, 121 premenopausal women, 124 postmenopausal women, and 168 men. Body composition was assessed using DXA, as was areal bone mineral density (aBMD) of spine, femur and whole body. In addition, pQCT was used to determine bone properties at tibial mid…

MaleBone densityPhysiologyOsteopenia and Osteoporosislcsh:MedicineBioinformaticsBiochemistryBone remodelingCell SignalingEndocrine SignalingBone DensitySex factorsMedicine and Health SciencesFemurlcsh:Science10. No inequalityta315Aged 80 and overLumbar VertebraeMultidisciplinaryHuman studiesAge FactorsNeurochemistryta3141Middle AgedPostmenopauseBody CompositionOsteocalcinFemaleResearch ArticleSignal TransductionAdultmusculoskeletal diseasesSerotoninmedicine.medical_specialtyContext (language use)BiologyAge and genderSex FactorsInternal medicinemedicineHumansAgedEndocrine Physiologylcsh:RBiology and Life SciencesNeuroendocrinologyCell BiologyRadiographyEndocrinologybiology.proteinWomen's Healthlcsh:QEndocrine-Related SubstancesSerotoninPLOS ONE
researchProduct

Cannabinoid receptor 1 and acute resistance exercise – In vivo and in vitro studies in human skeletal muscle

2015

Abstract Aim This study aimed to determine whether Cannabinoid receptor 1 (CB1) is involved in mammalian target of rapamycin (mTOR) signaling and skeletal muscle protein synthesis. Methods This study used human vastus lateralis skeletal muscle biopsies obtained before and after a resistance exercise (RE) bout in young men (n = 18). The signaling mechanisms were studied in vitro in human myotubes. Protein expression was determined by Western blot and confocal microscopy, and gene expression by quantitative PCR. Protein synthesis was measured in vitro using puromycin-based SuNSET technique. Results In human skeletal muscle, an anabolic stimulus in the form of RE down-regulated CB1 expression.…

Malemedicine.medical_specialtyPhysiologyMAP Kinase Signaling SystemMuscle Fibers SkeletalGene ExpressionSkeletal muscleP70-S6 Kinase 1Cell Cycle ProteinsBiochemistryCell LineCellular and Molecular NeuroscienceYoung AdultEndocrinologyPiperidinesReceptor Cannabinoid CB1Internal medicinemedicineCannabinoid receptor type 2HumansCannabinoid receptor 1PhosphorylationMuscle Skeletalta315PI3K/AKT/mTOR pathwayAdaptor Proteins Signal TransducingChemistryMyogenesista1184Eukaryotic initiation factor 4E bindingSkeletal muscleRibosomal Protein S6 Kinases 70-kDaResistance TrainingPhosphoproteinsResistance exerciseCell biologymedicine.anatomical_structureEndocrinologyRibosomal protein s6Protein BiosynthesismTOR signalingPhosphorylationPyrazolesProtein synthesisProtein Processing Post-TranslationalPeptides
researchProduct

103 Tibial Guided Wave Ultrasound in the Assessment of Osteoporosis in Elderly Women

2009

medicine.medical_specialtyGuided wave testingbusiness.industryEndocrinology Diabetes and MetabolismUltrasoundOsteoporosisPhysical therapyMedicineRadiology Nuclear Medicine and imagingOrthopedics and Sports MedicineRadiologybusinessmedicine.diseaseJournal of Clinical Densitometry
researchProduct

Bone mineral density and physical activity in 50–60-year-old women

1991

Abstract The bone mineral density (BMD) of the calcaneus was measured utilizing a single energy photon absorption method in 108 women, aged 50–60 years. The women who participated in vigorous exercise two or more times a week or whose total physical activity amounted to 4 h a week had significantly higher BMD values than those who exercised less than two times a week or did less than 4 h physical activity a week. The physically active women also showed higher values for leg extension force and maximal oxygen uptake. BMD and leg extension force were positively correlated, whereas correlations between BMD and body mass, and the width of the calcaneus were negative. When other life-style varia…

Total physical activitymedicine.medical_specialtyAlcohol DrinkingOsteoporosisPhysical activityPhysiologyPhysical Therapy Sports Therapy and RehabilitationPhysical exerciseBiochemistryBone and BonesAbsorptiometry PhotonOxygen ConsumptionEndocrinologyBone DensityHumansMedicineOrthopedics and Sports MedicineExerciseFinlandBone mineralbusiness.industrySignificant differenceBody WeightSmokingVO2 maxMiddle Agedmusculoskeletal systemmedicine.diseaseSkeleton (computer programming)Body HeightMiddle ageBiomechanical PhenomenaSurgeryCalcaneusSkinfold ThicknessOsteoporosisLeg extensionFemaleSurgeryCalcaneusbusinessBone and Mineral
researchProduct

Strategies to improve vitamin D status in northern European children: exploring the merits of vitamin D fortification and supplementation.

2006

Adequacy of vitamin D in children in Europe has been the focus of a number of investigations. The results of measuring serum levels of 25-hydroxyvitamin D show high prevalence of vitamin D deficiency during the winter with lower prevalence during the summer. National policies on food fortification or individual supplementation with vitamin D have been recently revisited by the individual countries and the European Union as a whole. Optiford is a project managed by a coalition of scientists formed to optimize vitamin D fortification in the northern European Countries, was given the task to decide if food fortification with vitamin D is feasible and to provide a scientific basis for setting t…

Pediatricsmedicine.medical_specialtyAdolescent030309 nutrition & dieteticsFortificationMedicine (miscellaneous)Nutritional Status030209 endocrinology & metabolismvitamin D deficiencyNutrition Policy03 medical and health scienceschemistry.chemical_compound0302 clinical medicineEnvironmental healthmedicineVitamin D and neurologymedia_common.cataloged_instanceHumansEuropean unionVitamin DChildFinlandmedia_commonAgedCalcifediol0303 health sciencesNutrition and DieteticsHigh prevalencebusiness.industryFood fortificationmedicine.diseaseVitamin D Deficiency3. Good healthDietEuropechemistryDietary SupplementsFood FortifiedLower prevalenceSunlightCalcifediolFemaleSeasonsbusinessThe Journal of nutrition
researchProduct

Growth of osteoblasts on lithographically modified surfaces

2007

Here we report about preliminary investigations on developing substrates for culturing osteoblasts, the cells responsible for production of mineralised bone, by lithographically modifying the surfaces of several materials. The proton beam writing system at the National University of Singapore was used to fabricate high aspect ratio structures in PMMA, while two-dimensional low aspect ratio structures were fabricated using conventional electron beam lithography (EBL) and UV lithography (UVL) in SU-8. It was found that oxygen plasma treatment of structured SU-8 surfaces changed the surface layer and significantly improved cell attachment and proliferation. Cells grown on patterned thick PMMA …

Nuclear and High Energy PhysicsMaterials scienceAspect ratio (aeronautics)Scanning electron microscopetechnology industry and agricultureNanotechnologyOsteoblastProton beam writinglaw.inventionmedicine.anatomical_structurelawOxygen plasmamedicineSurface layerPhotolithographyInstrumentationElectron-beam lithographyNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Relation of PvuII site polymorphism in the COL1A2 gene to the risk of fractures in prepubertal Finnish girls.

2003

Genetic susceptibility to fractures may be detectable in early childhood. We evaluated the associations between the polymorphic PvuII site of the COL1A2 gene and bone properties assessed by different modalities (dual-energy X-ray absorptiometry; peripheral quantitative computed tomography; gel coupling scanning quantitative ultrasonometry; ultrasound bone sonometry), bone turnover markers, and the occurrence of fractures in 244 prepubertal Finnish girls. Tanner stage and physical characteristics did not differ significantly among girls with different COL1A2 genotypes. The polymorphism was not significantly associated with different bone properties or any of the bone turnover markers when gi…

medicine.medical_specialtyBone densityPhysiologyOsteoporosisBiologyPolymorphism Single NucleotideCollagen Type IBone remodelingFractures BoneBone DensityRisk FactorsInternal medicineGenotypeGeneticsmedicineHumansGenetic Predisposition to DiseaseTibiaQuantitative computed tomographyChildDeoxyribonucleases Type II Site-SpecificFinlandRetrospective StudiesBone mineralBinding SitesPolymorphism Geneticmedicine.diagnostic_testPubertyAnthropometrymedicine.diseaseEndocrinologyFemaleBone RemodelingCollagenPhysiological genomics
researchProduct

Bone and Muscle Development During Puberty in Girls: A Seven-Year Longitudinal Study

2009

The growth of lean mass precedes that of bone mass, suggesting that muscle plays an important role in the growth of bone. However, to date, no study has directly followed the growth of bone and muscle size through puberty and into adulthood. This study aimed to test the hypothesis that the growth of muscle size precedes that of bone size (width and length) and mass during puberty. Bone and muscle properties were measured using pQCT and DXA in 258 healthy girls at baseline (mean age, 11.2 yr) and 1-, 2-, 3-4- and 7-yr follow-up. Growth trends as a function of time relative to menarche were determined from prepuberty to early adulthood for tibial length (TL), total cross-sectional area (tCSA)…

Adultmedicine.medical_specialtyLongitudinal studyMuscle sizeAdolescentEndocrinology Diabetes and MetabolismMuscle DevelopmentGrowth velocityBone DensityOsteogenesisInternal medicinePrepubertymedicineHumansOrthopedics and Sports MedicineLongitudinal StudiesMuscle StrengthChildMuscle forceBone growthTibiabusiness.industryPubertyMiddle AgedEndocrinologyLean body massMenarcheFemalebusinessJournal of Bone and Mineral Research
researchProduct

Vitamin D, parathyroid hormone, and bone mass in adolescents.

2005

This article provides a review of the evidence identifying the factors related to vitamin D status in adolescents. The prevalence of vitamin D deficiency based on 25-hydroxyvitamin D [25(OH)D] of <25 nmol/L ranges from 0 to 32% depending on the season measured and the latitude of the population assessed. The factors that have been reported to affect serum 25(OH)D in adolescents include ethnicity, gender, puberty stage, parathyroid hormone (PTH), dietary vitamin D intake, and sun exposure. Vitamin D supplementation studies are limited to small populations and with supplementation focused on winter months when sunlight may be inadequate. The effects of vitamin D status and supplementation on …

Malemedicine.medical_specialtyAdolescentAdolescent Nutritional Physiological PhenomenaPopulationMedicine (miscellaneous)Parathyroid hormoneNutritional Statusvitamin D deficiencyBone DensityInternal medicinemedicineVitamin D and neurologyHumansVitamin DeducationSunlightCalcium metabolismeducation.field_of_studyNutrition and DieteticsVitamin d supplementationbusiness.industryPubertymedicine.diseaseDietEndocrinologyParathyroid HormoneDietary SupplementsSunlightCalciumFemalebusinessBone massThe Journal of nutrition
researchProduct

Weight-bearing, muscle loading and bone mineral accrual in pubertal girls--a 2-year longitudinal study.

2007

Abstract Objectives: The mechanical environment is considered to be the most important determinant of bone strength. Local muscle force, in turn, is regarded as the largest source of loading applied to bones. However, the effect of weight-bearing on bone mineral accrual is unclear. Comparing the relationship between muscle force and bone mineral content (BMC) in the upper and lower limbs provides a means of investigating this issue. Subjects and methods : The study group comprised 258 healthy girls aged 10–13 years old at baseline. BMC, lean body mass (LM) and fat body mass (FM) of total body were assessed by dual-energy X-ray absorptiometry at baseline and 2 years after. The maximal isomet…

medicine.medical_specialtyHistologyTime FactorsAdolescentPhysiologyEndocrinology Diabetes and MetabolismCoefficient of variationElbowIsometric exercisemedicine.disease_causeWeight-bearingBody Mass IndexWeight-BearingBone DensitymedicineHumansLongitudinal StudiesChildBone mineralOrthodonticsbusiness.industryMusclesPubertymusculoskeletal systembody regionsmedicine.anatomical_structureLean body massPhysical therapyUpper limbFemalemedicine.symptombusinesshuman activitiesMuscle contractionFollow-Up StudiesMuscle ContractionBone
researchProduct

Thickness sensitivity of ultrasound velocity in long bone phantoms

2004

One approach to bone disease diagnosis such as osteoporosis is to measure the velocity of ultrasound propagating axially along long bones. In this study, the variation in velocity as a function of radial position was assessed using two polyvinyl chloride (PVC) bone phantoms with cross-sectional geometry similar to the human tibia but differing in medullary cavity diameter. Two ultrasonometers were used: these were a commercial device operating at a relatively high frequency (HF) of 1.25 MHz and a prototype low frequency (LF) device operating at approximately 200 kHz. The LF measurements showed a larger variation with radial position, with changes in velocity of up to 20% occurring around th…

Materials scienceAcoustics and UltrasonicsBone diseaseMedullary cavityLong boneBiophysicsLow frequencyBone and BonesImaging phantommedicineHumansUltrasonicsRadiology Nuclear Medicine and imagingTibiaPolyvinyl ChlorideUltrasonographyTibiaRadiological and Ultrasound TechnologyPhantoms Imagingbusiness.industryUltrasoundAnatomymedicine.diseasemedicine.anatomical_structureOsteoporosisbusinessAxial symmetryBiomedical engineeringUltrasound in Medicine &amp; Biology
researchProduct

Normal-weight obesity and cardiometabolic risk: A 7-year longitudinal study in girls from prepuberty to early adulthood

2017

Objective To study whether normal-weight obesity in childhood is associated with increased cardiometabolic risk in early adulthood. Methods This study assessed data for 236 girls followed from prepuberty to early adulthood. Growth chart data were obtained from birth to 18 years. Body composition was assessed by dual-energy x-ray absorptiometry and cardiometabolic risk by calculating continuous clustered risk score (at ages 11, 14, and 18). The association of body weight status with cardiometabolic risk from childhood to early adulthood was examined. Results Subjects with normal-weight obesity were virtually indistinguishable from their normal-weight lean peers in terms of relative body weig…

medicine.medical_specialtyGrowth chartLongitudinal studyPediatricsNutrition and DieteticsFramingham Risk Scorebusiness.industryEndocrinology Diabetes and MetabolismMedicine (miscellaneous)030209 endocrinology & metabolismmedicine.diseaseObesityBody fat percentage03 medical and health sciencesNormal weight obesity0302 clinical medicineEndocrinologyEndocrinologyPrepubertyInternal medicinemedicine030212 general & internal medicinebusinessBody mass indexObesity
researchProduct

Toll-like receptor 5 in obesity: The role of gut microbiota and adipose tissue inflammation

2015

Objective This study aimed at establishing bacterial flagellin-recognizing toll-like receptor 5 (TLR5) as a novel link between gut microbiota composition, adipose tissue inflammation, and obesity. Methods An adipose tissue microarray database was used to compare women having the highest (n = 4, H-TLR) and lowest (n = 4, L-TLR) expression levels of TLR5-signaling pathway genes. Gut microbiota composition was profiled using flow cytometry and FISH. Standard laboratory techniques were used to determine anthropometric and clinical variables. In vivo results were verified using cultured human adipocytes. Results The H-TLR group had higher flagellated Clostridium cluster XIV abundance and Firmicu…

medicine.medical_specialtyNutrition and DieteticsbiologyAdiponectinEndocrinology Diabetes and MetabolismAdipose tissue macrophagesLeptinMedicine (miscellaneous)Adipose tissueInflammationGut florabiology.organism_classification3. Good healthInsulin receptorEndocrinologyEndocrinologyTLR5Internal medicinemedicinebiology.proteinmedicine.symptomObesity
researchProduct

Body Composition and Fitness during Strength and/or Endurance Training in Older Men

2008

PURPOSE: This study examined adaptations in body composition and physical fitness during a 21-wk strength and/or endurance training period in 40- to 65-yr-old men. We also compared the usefulness of different methods for the analysis of body composition to detect training-induced adaptations. METHODS: Fifty-three men were randomized into the endurance training (E: N = 14), strength training (S: N = 13), combined strength and endurance training (SE: N = 15), or control (C: N = 11) groups. S and E trained 2 and SE 2 x 2 times a week for strength and endurance. RESULTS: Percentage of fat (fat%) decreased (5-8%) similarly in all training groups. Fat% measured by DXA at baseline and its change c…

AdultMalemedicine.medical_specialtyWaistStrength trainingPhysical fitnessPhysical Therapy Sports Therapy and RehabilitationAbsorptiometry PhotonOxygen ConsumptionAnimal scienceEndurance trainingElectric ImpedanceHumansMedicineOrthopedics and Sports MedicineAgedAnalysis of VariancePhysical Education and Trainingbusiness.industryReproducibility of ResultsVO2 maxMiddle AgedAdaptation PhysiologicalWaistlinePhysical FitnessBody CompositionExercise TestPhysical EndurancePhysical therapyLean body massAnalysis of variancebusinessMedicine &amp; Science in Sports &amp; Exercise
researchProduct

Physical activity, physical fitness, diet and the health in young people

2012

The beneficial effects of appropriate physical activity(PA), physical fitness,and diet during adult life are well-documented but the potential of appropriate PA,physical fitness,and diet to confer benefits on health and well-being during childhood and adolescence has not been explored fully.Recognizing the value of critical reviews of the extant literature in providing a foundation for future research,the Journal of Sport and Health Science(JSHS) has commissioned two Special Issues devoted

GerontologyAdult lifeExtant taxonbusiness.industryHealth sciencePhysical fitnessPhysical activityPhysical Therapy Sports Therapy and RehabilitationOrthopedics and Sports MedicinePsychologybusinessBeneficial effectsDevelopmental psychologyJournal of Sport and Health Science
researchProduct

Effect of aerobic exercise on insulin resistance and central adiposity disappeared after the discontinuation of intervention in overweight women

2016

Purpose: This study aimed to assess whether the benefits of exercise on central adiposity and insulin resistance (HOMA-IR) are maintained after discontinuation of intervention in the overweight/obese (OWOB) women. Methods: The study subjects were from 2 independent studies with similar aerobic exercise (AE) intervention programs. In study I, 15 OWOB postmenopausal women with pre-diabetes (body mass index, BMI = 24–33 kg/m2 , aged 52–65 years) completed an 8-month exercise intervention and were followed for 2 years after the intervention. In study II, 12 OWOB (BMI = 25–35 kg/m2 , aged 30–50 years) premenopausal women participated in a 6-week AE and were followed for 4 years after the interve…

medicine.medical_specialtypremenopause030209 endocrinology & metabolismPhysical Therapy Sports Therapy and RehabilitationOverweight03 medical and health scienceslcsh:GV557-1198.9950302 clinical medicineInsulin resistanceIntervention (counseling)medicineAerobic exerciseta319Exercise interventionOrthopedics and Sports MedicineSpecial issue on "Physical activity continuum throughout the lifespan: is exercise a medicine or what?"030212 general & internal medicineObesityexercise interventionRelapselcsh:Sports medicineta315lcsh:SportsExercise interventionrelapsibusiness.industrynutritional and metabolic diseasesmedicine.diseaseObesityDiscontinuationPostmenopausepostmenopausePremenopausePhysical therapyCentral Adipositylihavuusmedicine.symptombusinesslcsh:RC1200-1245Journal of Sport and Health Science
researchProduct

Authors’ Response: Relationship of Sex Hormones to Bone Geometric Properties and Mineral Density in Early Pubertal Girls: Use of Correlation Analyses

2004

medicine.medical_specialtyEndocrinology Diabetes and MetabolismBiochemistry (medical)Clinical BiochemistryBiologyBiochemistryCorrelationEndocrinologyMineral densityEndocrinologyGonadal Steroid HormonesInternal medicinemedicineHormoneThe Journal of Clinical Endocrinology &amp; Metabolism
researchProduct

Fat mass accumulation compromises bone adaptation to load in finnish women: A cross-sectional study spanning three generations

2010

Body weight and lean mass correlate with bone mass, but the relationship between fat mass and bone remains elusive. The study population consisted of 396 girls and 138 premenopausal mothers and 114 postmenopausal grandmothers of these girls. Body composition and tibial length were assessed using dual-energy X-ray absorptiometry (DXA), and bone traits were determined at the tibia using peripheral quantitative computed tomography (pQCT) in the girls at the ages of 11.2 ± 0.8, 13.2 ± 0.9, and 18.3 ± 1.0 years and in the mothers (44.7 ± 4.1 years) and grandmothers (70.7 ± 6.3 years). The values of relative bone strength index (RBSI), an index reflecting the ratio of bone strength to the load ap…

medicine.medical_specialtymedicine.diagnostic_testbusiness.industryCross-sectional studyEndocrinology Diabetes and Metabolismmedicine.disease_causeWeight-bearingFat massEndocrinologyInternal medicineLean body massMedicinePopulation studyOrthopedics and Sports MedicineTibiaQuantitative computed tomographybusinessBone massJournal of Bone and Mineral Research
researchProduct

Gut-adipose tissue axis in hepatic fat accumulation in humans

2014

Recent evidence suggests that in animals gut microbiota composition (GMC) affects the onset and progression of hepatic fat accumulation. The aim of this study was to investigate in humans whether subjects with high hepatic fat content (HHFC) differ in their GMC from those with low hepatic fat content (LHFC), and whether these differences are associated with body composition, biomarkers and abdominal adipose tissue inflammation.Hepatic fat content (HFC) was measured using proton magnetic resonance spectroscopy ((1)H MRS). Fecal GMC was profiled by 16S rRNA fluorescence in situ hybridization and flow cytometry. Adipose tissue gene expression was analyzed using Affymetrix microarrays and quant…

AdultMalemedicine.medical_specialtyPathologyeducationGene ExpressionAdipose tissueFaecalibacterium prausnitziiInflammationGut florata3111Insulin resistanceNon-alcoholic Fatty Liver DiseaseInternal medicineGene expressionmedicineHumansTriglyceridesInflammationHepatologybiologymedicine.diagnostic_testMicrobiotata1183ta1182ta3141Middle Agedta3121biology.organism_classificationmedicine.diseaseCross-Sectional StudiesEndocrinologyReal-time polymerase chain reactionAdipose TissueLiverBody CompositionFemaleInsulin Resistancemedicine.symptomDigestive SystemFluorescence in situ hybridizationJournal of Hepatology
researchProduct

Endogenous Hormones, Muscle Strength, and Risk of Fall-Related Fractures in Older Women

2006

Background. Among older people, fracture-causing fall often leads to health deterioration. The role of endogenous hormone status and muscle strength on fall-related fracture risk is unclear. This study investigates if, after adjustment for bone density, endogenous hormones and muscle strength would predict fall-related limb fracture incidence in older community-dwelling women followed-up over 10 years. Methods. As a part of a prospective population-based study, 187 75-year-old women were investigated. Serum estradiol, testosterone, sex hormone binding globulin, and dehydroepiandrosterone sulfate concentrations were analyzed, and isometric muscle strength and bone mineral density were assess…

Agingmedicine.medical_specialtyTime FactorsBone densityPopulationIsometric exerciseFractures Bonechemistry.chemical_compoundDehydroepiandrosterone sulfateSex hormone-binding globulinRisk FactorsSex Hormone-Binding GlobulinInternal medicinemedicineHumansTestosteroneProspective StudiesMuscle SkeletaleducationTestosteroneAgedBone mineraleducation.field_of_studyEstradiolbiologyDehydroepiandrosterone Sulfatebusiness.industryLimb fractureEndocrinologychemistrybiology.proteinAccidental FallsFemaleGeriatrics and GerontologybusinessFollow-Up StudiesThe Journals of Gerontology Series A: Biological Sciences and Medical Sciences
researchProduct

Bone mineral density in relation to anthropometric properties, physical activity and smoking in 75-year-old men and women

1993

Bone mineral content (BMC, gem−2) and density (BMD, gem−3) were studied in 75-year-old men and women in relation to anthropometric and certain life-style factors. This study covered all the men and women born in 1914 who were residents in the city of Jyvaskyla in 1989 (N=388). A hundred and three men and 188 women participated in bone measurements performed at the calcaneus using a 125I-photon absorption method. BMC was on average 36% and BMD 17% higher in the men than in the women. BMC and BMD associated with body mass in both sexes, and with body fat and use of estrogen in the women. There was a negative correlation between the BMD values and the number of cigarettes smoked over the entir…

Malemusculoskeletal diseasesAgingmedicine.medical_specialtyPhysical activityBone MeasurementsSex FactorsBone DensityHumansMedicineExerciseAgedBone mineralAnthropometrybusiness.industrymusculoskeletal neural and ocular physiologyBody WeightEstrogen Replacement TherapySmokingAnthropometrymusculoskeletal systemBody HeightPhysical therapyLife course approachBone mineral contentFemaleCalcaneusGeriatrics and GerontologyNegative correlationbusinessDemographyAging Clinical and Experimental Research
researchProduct

Differences in estimates of change of bone accrual and body composition in children because of scan mode selection with the prodigy densitometer.

2004

Abstract Girls of age 10–13 yr with Tanner stage I–III maturation status ( n = 155) were measured using the Prodigy (GE Lunar) densitometer. Bone area (BA), bone mineral content (BMC), and bone mineral density (BMD) were assessed for the whole body, lumbar spine, and proximal femur using the Thin (T) and Standard (S) scan modes at years 1 and 3 of the study. The differences obtained between the T and S mode at year 1 were 1–2% for the lumbar spine and proximal femur and 5–11% for the whole body. For those girls whose default mode changed from T at year 1 to S mode at year 3, the estimated gain in BA, BMC, and BMD was 3.4%, 7.6%, and 3.1% respectively, lower than that obtained when scanning …

musculoskeletal diseasesBone accrualAdolescentEndocrinology Diabetes and MetabolismAbsorptiometry PhotonBone DensityMedicineHumansRadiology Nuclear Medicine and imagingOrthopedics and Sports MedicineDensitometerFemurChildBone mineralLumbar Vertebraebusiness.industryMode selectionAnatomyBone areamusculoskeletal systemIntervention studiesBody CompositionBone mineral contentFemaleNuclear medicinebusinessWhole bodyJournal of clinical densitometry : the official journal of the International Society for Clinical Densitometry
researchProduct

Foot Strike Pattern, Step Rate, and Trunk Posture Combined Gait Modifications to Reduce Impact Loading during Running

2019

Elevated impact loading can be detrimental to runners as it has been linked to the increased risk of tibial stress fracture and plantar fasciitis. The objective of this study was to investigate the combined effects of foot strike pattern, step rate, and anterior trunk lean gait modifications on impact loading in runners. Nineteen healthy runners performed 12 separate gait modification trials involving: three foot strike patterns (rearfoot, midfoot, and forefoot strike), two step rates (natural and 10% increased), and two anterior trunk lean postures (natural and 10-degree increased flexion). Overall, forefoot strike combined with increased step rate led to the lowest impact loading rates, a…

AdultMaleFoot strikelanding patternmedicine.medical_specialtyFractures Stress0206 medical engineeringBiomedical EngineeringBiophysicsPlantar fasciitis02 engineering and technologyRunningjuoksu03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationGait (human)medicineHumansOrthopedics and Sports MedicineRange of Motion ArticularTrunk postureta315GaitpostureryhtiFootbusiness.industryForefootRehabilitationvertical loadingTorso020601 biomedical engineeringTrunkBiomechanical PhenomenaTibial Fracturesbody regionsImpact loadingFemalecadencebiomekaniikkamedicine.symptombusinessCadencehuman activities030217 neurology & neurosurgerydistance runnersJournal of Biomechanics
researchProduct

Diurnal Variation in Maximal and Submaximal Strength, Power and Neural Activation of Leg Extensors in Men: Multiple Sampling Across Two Consecutive D…

2007

This study aimed to compare day-to-day repeatability of diurnal variation in strength and power. Thirty-two men were measured at four time points (07 : 00 - 08 : 00, 12 : 00 - 13 : 00, 17 : 00 - 18 : 00, and 20 : 30 - 21 : 30 h) throughout two consecutive days (day 1 and day 2). Power during loaded squat jumps, torque and EMG during maximal (MVC) and submaximal (MVC40) voluntary isometric knee extension contractions were measured. The EMG/torque ratio during MVC and MVC40 was calculated to evaluate neuromuscular efficiency. A significant time-of-day effect with repeatable diurnal patterns was found in power. In MVC, a significant time-of-day effect was present on day 2, whereas day 1 showed…

AdultMalemedicine.medical_specialtyPhysical Therapy Sports Therapy and RehabilitationSquatElectromyographyIsometric exerciseBody TemperatureAnimal scienceIsometric ContractionmedicineHumansOrthopedics and Sports MedicineMuscle StrengthCircadian rhythmMuscle SkeletalMotor Neuronsmedicine.diagnostic_testMuscle fatigueElectromyographybusiness.industryDiurnal temperature variationRepeatabilityCircadian RhythmPower (physics)Surgerybody regionsLower ExtremityTorqueMuscle FatiguebusinessInternational Journal of Sports Medicine
researchProduct

Tartrate-Resistant Acid Phosphatase 5b: A Novel Serum Marker of Bone Resorption

2000

Human serum contains two forms of tartrate-resistant acid phosphatase (TRAP), 5a and 5b. Of these, 5a contains sialic acid and 5b does not. We show here that antigenic properties and pH optimum of TRAP purified from human osteoclasts are identical to those of serum TRAP 5b and completely different from those of serum TRAP 5a, suggesting that 5b would be derived from osteoclasts and 5a from some other source. We developed a novel immunoassay specific for 5b using a monoclonal antibody O1A as capture antibody. O1A did not bind acid phosphatase derived from platelets and erythrocytes. Western analysis showed that O1A was specific for TRAP in both human bone and serum. We measured bound TRAP ac…

medicine.medical_specialtyEndocrinology Diabetes and MetabolismAcid PhosphataseNeuraminidaseBone resorptionPlaceboschemistry.chemical_compoundDouble-Blind MethodReference ValuesOsteoclastInternal medicineEnzyme StabilitymedicineHumansOrthopedics and Sports MedicineBone ResorptionIncubationTartrate-resistant acid phosphataseEstradiolmedicine.diagnostic_testbiologyTartrate-Resistant Acid PhosphataseEstrogen Replacement TherapyAcid phosphataseAntibodies MonoclonalMiddle AgedSialic acidResorptionIsoenzymesPostmenopauseEndocrinologymedicine.anatomical_structurechemistryImmunoassaybiology.proteinFemaleNorethindroneBiomarkersJournal of Bone and Mineral Research
researchProduct

Are skeletal muscle FNDC5 expression and irisin release regulated by exercise and related to health?

2013

Recently, contradictory findings have been reported concerning the function of irisin and its precursor gene, skeletal muscle FNDC5, in energy homeostasis, and the associated regulatory role of exercise and PGC-1α. We therefore evaluated whether muscle FNDC5 mRNA and serum irisin are exercise responsive and whether PGC-1α expression is associated with FNDC5 expression. The male subjects in the study performed single exercises: (1) 1 h low-intensity aerobic exercise (AE) (middle-aged, n= 17), (2) a heavy-intensity resistance exercise (RE) bout (young n= 10, older n= 11) (27 vs. 62 years), (3) long-term 21 weeks endurance exercise (EE) training alone (twice a week, middle-aged, n= 9), or (4) …

irisiiniexerciseluurankolihasskeletal muscleliikuntairisin
researchProduct

Effects of exercise and dietary intervention on serum metabolites in men with insomnia symptoms : a 6-month randomized-controlled trial

2020

Accumulating evidence show that exercise and diet interventions are associated with improved sleep quality. Studies investigating the effects of exercise and dieting on circulating metabolomics in people with sleep disorders, particularly insomnia, are scarce. The present study is a part of a 6-month randomized lifestyle intervention on sleep disorder subjects. Seventy-two Finnish men (aged: 51.6 ± 10.1 years) with chronic insomnia symptoms who were assigned into different intervention groups completed this study (exercise n = 24, diet n = 27 and control n = 21). We found exercise and diet intervention were associated with improved sleep quality and a number of metabolites across different …

aineenvaihduntahäiriötexercisekuntoliikuntainsomniainterventiohoitodietruokavaliotmetabolomicsunettomuusliikuntahoito
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Body composition in 18 to 88-year-old adults - comparison of multifrequency bioimpedance and dual-energy X-ray absorptiometry

2014

Objective -- This study compared bioimpedance analysis (BIA) in the assessment of body composition with dual-energy X-ray absorptiometry (DXA) in 18- to 88-year-old adults. Design and Methods -- Body composition of 882 adults was estimated by eight-polar BIA and DXA. In addition, estimates of lean mass, fat mass, and percentage of fat were investigated across a range of age and leisure time physical activity (LTPA) groups. Results -- Compared to DXA, larger lean masses (mean difference 2.9 and 1.6 kg) and smaller fat masses (3.1 and 2.6 kg) were estimated by BIA in both women and men, respectively. Differences between the methods' mean values were evident in all age and LTPA groups, except …

DXABIAdual-energy x-ray absorptiometry (DXA)rasvaprosenttibioimpedanssianalyysibioelectrical impedance method (BIA)rasvakudoksethuman activitiesmittausmenetelmätkehonkoostumus
researchProduct

Muscle and serum metabolomes are dysregulated in colon-26 tumor-bearing mice despite amelioration of cachexia with activin receptor type 2B ligand bl…

2019

Cancer-associated cachexia reduces survival, which has been attenuated by blocking the activin receptor type 2B (ACVR2B) ligands in mice. The purpose of this study was to unravel the underlying physiology and novel cachexia biomarkers by use of the colon-26 (C26) carcinoma model of cancer cachexia. Male BALB/c mice were subcutaneously inoculated with C26 cancer cells or vehicle control. Tumor-bearing mice were treated with vehicle (C26+PBS) or soluble ACVR2B either before (C26+sACVR/b) or before and after (C26+sACVR/c) tumor formation. Skeletal muscle and serum metabolomics analysis was conducted by gas chromatography-mass spectrometry. Cancer altered various biologically functional groups …

ribosomitribosomephenylalaninemyostatinsyöpätauditlihaksetaineenvaihduntatuotteetC26proteiinitskeletal musclelihassurkastumasairaudet
researchProduct

Self-selected running gait modifications reduce acute impact loading, awkwardness, and effort

2021

Impact loading has been associated with running-related injuries, and gait retraining has been suggested as a means of reducing impact loading and lowering the risk of injury. However, gait retraining can lead to increased perceived awkwardness and effort. The influence of specifically trained and self-selected running gait modifications on acute impact loading, perceived awkwardness and effort is currently unclear. Sixteen habitual rearfoot/midfoot runners performed forefoot strike pattern, increased step rate, anterior trunk lean and self-selected running gait modifications on an instrumented treadmill based on real-time biofeedback. Impact loading, perceived awkwardness and effort scores…

body regionslanding patternryhtirasitusvammataskeleetvertical loadingbiomekaniikkahuman activitiesstep rateposturejuoksu
researchProduct

Validity of three smartwatches in estimating energy expenditure during outdoor walking and running.

2022

Commercially wrist-worn devices often present inaccurate estimations of energy expenditure (EE), with large between-device differences. We aimed to assess the validity of the Apple Watch Series 6 (AW), Garmin FENIX 6 (GF) and Huawei Watch GT 2e (HW) in estimating EE during outdoor walking and running. Twenty young normal-weight Chinese adults concurrently wore three index devices randomly positioned at both wrists during walking at 6 km/h and running at 10 km/h for 2 km on a 400- meter track. As a criterion, EE was assessed by indirect calorimetry (COSMED K5). For walking, EE from AW and GF was significantly higher than that obtained by the K5 (p &amp;lt; 0.001 and 0.002, respectively), but…

tarkkuusPhysiologyphysical activityälykellotmonitorointikävelyjuoksuvalidation accuracywearable deviceshealth monitoringvalidointiPhysiology (medical)mittarit (mittaus)puettava teknologiafyysinen aktiivisuusenergiankulutus (aineenvaihdunta)Frontiers in physiology
researchProduct

Normal-weight obesity and cardiometabolic risk : A 7-year longitudinal study in girls from prepuberty to early adulthood

2017

Objective: To study whether normal-weight obesity in childhood is associated with increased cardiometabolic risk in early adulthood. Methods: This study assessed data for 236 girls followed from prepuberty to early adulthood. Growth chart data were obtained from birth to 18 years. Body composition was assessed by dual-energy x-ray absorptiometry and cardiometabolic risk by calculating continuous clustered risk score (at ages 11, 14, and 18). The association of body weight status with cardiometabolic risk from childhood to early adulthood was examined. Results: Subjects with normal-weight obesity were virtually indistinguishable from their normal-weight lean peers in terms of relative body w…

childrencardiometabolic riskrasvaprosenttisydän- ja verisuonitauditlihavuuslapset (ikäryhmät)ylipainoadolescentsbody fat percentageriskitnormal-weight obesitypainonhallintakehonkoostumus
researchProduct

Randomoitu kontrolloitu tutkimus keski-ikäisten miesten unettomuudesta

2014

Unettomuus on yleinen ongelma, jonka hoito on kansaterveydellisesti erittäin tärkeää. Koska unettomuuden yleisimmällä hoitokeinolla lääkityksellä on paljon haitallisia sivuvaikutuksia, on tärkeää tutkia unettomuuden vaihtoehtoisia hoitokeinoja. Tämän Pro Gradu -tutkielman tarkoituksena on selvittää kestävyysliikunnan vaikutusta unen laatuun ja määrään keski-ikäisillä unettomuudesta kärsivillä miehillä. Satunnaistetussa kontrolloidussa tutkimuksessa 42 vähän liikkuvaa vapaaehtoista 30–65-vuotiasta unettomuudesta kärsivää miestä Keski-Suomen sairaanhoitopiiristä (keski-ikä 51 [1.6] vuotta) jaettiin liikunta- ja kontrolliryhmään. Liikuntaryhmäläiset noudattivat yksilölli-sesti suunniteltua pro…

uniuneliaisuuskestävyysharjoittelukohtuutehoinen liikuntaliikuntaaerobinen harjoitteluunettomuus
researchProduct

Growth and aging of proximal femoral bone - a study with women spanning three generations

2015

Abstract. Osteoporotic hip fracture is a serious clinical event associated with high morbidity and mortality. Understanding femoral growth patterns is important for promoting bone health in the young and preventing fractures in later life. In this study, growth patterns of areal bone mineral density (aBMD) and geometric properties of the proximal femur were measured by dual-energy X-ray absorptiometry (GE Lunar Prodigy, USA). They were studied in 251 girls from premenarche (11.2±0.7 yrs) to late adolescence (18.3±1.1 yrs), and compared to their premenopausal mothers (n=128, aged 44.9±4.1 yrs) and postmenopausal grandmothers (n=128, aged 70.0±6.3 yrs). Hip axis length (HAL) was the first to …

musculoskeletal diseasesnaisettiheysgeometriabone strengthmurrosikälonkka
researchProduct

Influence of long-term postmenopausal hormone replacement therapy on estimated structural bone strength: A study in discordant monozygotic twins.

2011

Although postmenopausal hormone-replacement therapy (HRT) is known to prevent fractures, knowledge on the influence of long-term HRT on bone strength and its determinants other than areal bone mineral density is scarce. This study used a genetically controlled design with 24 monozygotic female twin pairs aged 54 to 72 years in which one cotwin was using HRT (mean duration 8 years) and the other had never used HRT. Estimated bone strength, cross-sectional area, volumetric bone mineral density, bone mineral mass, and cross-sectional density and mass distributions were assessed in the tibial shaft, distal tibia, and distal radius with peripheral computed tomography (pQCT). In the tibial shaft,…

luustoidenttiset kaksosetluuvaihdevuosien jälkeinen hormonikorvaushoitopostmenopausal hormone replacement therapy
researchProduct

Effect of aerobic exercise and low carbohydrate diet on pre-diabetic non-alcoholic fatty liver disease in postmenopausal women and middle aged men: s…

2014

Background. Pre-diabetes and non-alcoholic fatty liver disease (NAFLD) are associated with an unhealthy lifestyle and pose extremely high costs to the healthcare system. In this study, we aim to explore whether individualized aerobic exercise (AEx) and low carbohydrate diet (LCh) intervention affect hepatic fat content (HFC) in pre-diabetes via modification of gut microbiota composition and other post-interventional effects. Methods/design. A 6-month randomized intervention with 6-month follow-up is conducted from January 2013 to December 2015. The target sample size for intervention is 200 postmenopausal women and middle-aged men aged 50–65 year-old with pre-diabetes and NAFLD. The qualifi…

rasva-aineenvaihduntagut microbiotaglucose metabolismclinical settingmetabonomicshumanliver fat content
researchProduct

Movement characteristics during customized exergames after total knee replacement in older adults

2022

Introduction: There is limited understanding of how older adults can reach kinematic goals in rehabilitation while performing exergames and conventional exercises, and how similar or different the kinematics during exergaming are when compared with conventional therapeutic exercise with similar movement. The aim of this study was to describe the movement characteristics performed during exercise in custom-designed exergames and conventional therapeutic exercises among patients who have undergone unilateral total knee replacement (TKR). In addition, the secondary aim was to assess the relation of these exercise methods, and to assess participants' perceived exertion and knee pain during exer…

liikeoppiexercise therapypolvetliikeradatvideo gamesliikuntamusculoskeletal system3126 Surgery anesthesiology intensive care radiologyliiketuki- ja liikuntaelimetleikkaushoitofysioterapiarehabilitationkinematicskuntoutusphysical therapy
researchProduct

Exercise precision medicine for type 2 diabetics : Targeted benefit or risk?

2023

Concurrent exercise and metformin administration may reduce the acute and chronic effects of exercise on glucose metabolism in patients with type 2 diabetes (T2D). However, several studies suggest that combing metformin and exercise treatment may have no additive effect and even cause adverse effects in T2D patients. This case report aimed to highlight the challenges associated with prescribing exercise to type 2 diabetes patients undergoing metformin treatment. A 67-years old woman was followed-up for 5 months, including assessment of the acute and chronic glucose and lactate metabolism induced by concomitant exercise and metformin. The findings were four-fold: 1) During a high-intensity i…

tapaustutkimusverensokeriglukoosiaineenvaihduntablood glucosecase reportexercise interventionexercise medicinehyperlactatemialaktaatitaikuistyypin diabetesliikuntahoito
researchProduct

Trait-specific tracking and determinants of body composition: a 7-year follow-up study of pubertal growth in girls

2009

BACKGROUND: Understanding how bone (BM), lean (LM) and fat mass (FM) develop through childhood, puberty and adolescence is vital since it holds key information regarding current and future health. Our study aimed to determine how BM, LM and FM track from prepuberty to early adulthood in girls and what factors are associated with intra- and inter-individual variation in these three tissues. METHODS: The study was a 7-year longitudinal cohort study. BM, LM and FM measured using dual-energy X-ray absorptiometry, self-reported dietary information, leisure time physical activity (LTPA) and other factors were assessed one to eight times in 396 girls aged 10 to 13 years (baseline), and in 255 moth…

ravintobody compositiongrowthkehon koostumusadolescencetrackingliikuntakasvu
researchProduct