0000000000682125

AUTHOR

Claudio Borghi

showing 48 related works from this author

Hyperuricemia and Risk of Cardiovascular Outcomes: The Experience of the URRAH (Uric Acid Right for Heart Health) Project

2020

The latest European Guidelines of Arterial Hypertension have officially introduced uric acid evaluation among the cardiovascular risk factors that should be evaluated in order to stratify patient's risk. In fact, it has been extensively evaluated and demonstrated to be an independent predictor not only of all-cause and cardiovascular mortality, but also of myocardial infraction, stroke and heart failure. Despite the large number of studies on this topic, an important open question that still need to be answered is the identification of a cardiovascular uric acid cut-off value. The actual hyperuricemia cut-off (> 6 mg/dL in women and 7 mg/dL in men) is principally based on the saturation …

0301 basic medicineMaleTime FactorsDiseaseUric acid.chemistry.chemical_compound0302 clinical medicineRisk FactorsUric Acid Cardiovascular events epidemiologyEpidemiologyMulticenter Studies as TopicHyperuricemiaStrokeCardiovascular events; Cardiovascular mortality; Uric acid; URRAHMiddle AgedPrognosisObservational Studies as TopicItalyCardiovascular DiseasesResearch DesignFemaleCardiology and Cardiovascular MedicineAdultmedicine.medical_specialtyCardiovascular mortalityUric acid · Cardiovascular mortality · Cardiovascular events · URRAHContext (language use)Cardiovascular eventHyperuricemiaRisk AssessmentCardiovascular events03 medical and health sciencesURRAHcardiovascular events; cardiovascular mortality; urrah; uric acidPharmacotherapyInternal medicineInternal MedicinemedicineHumansAgedRetrospective Studiesbusiness.industrymedicine.disease030104 developmental biologychemistryHeart failureUric acidbusinessUric acid030217 neurology & neurosurgeryCardiovascular events; Cardiovascular mortality; Uric acid; URRAH; Adult; Aged; Biomarkers; Cardiovascular Diseases; Female; Humans; Hyperuricemia; Italy; Male; Middle Aged; Multicenter Studies as Topic; Observational Studies as Topic; Prognosis; Research Design; Retrospective Studies; Risk Assessment; Risk Factors; Time Factors; Uric AcidBiomarkers
researchProduct

Early Treatment With Zofenopril and Ramipril in Combination With Acetyl Salicylic Acid in Patients With Left Ventricular Systolic Dysfunction After A…

2017

Abstract: The SMILE-4 study showed that in patients with left ventricular dysfunction (LVD) after acute myocardial infarction, early treatment with zofenopril plus acetyl salicylic acid is associated with an improved 1-year survival, free from death or hospitalization for cardiovascular (CV) causes, as compared to ramipril plus acetyl salicylic acid. We now report CV outcomes during a 5-year follow-up of the patients of the SMILE-4 study. Three hundred eighty-six of the 518 patients completing the study (51.2%) could be tracked after the study end and 265 could be included in the analysis. During the 5.5 (±2.1) years of follow-up, the primary endpoint occurred in 27.8% of patients originall…

MaleCaptoprilTime FactorsMyocardial InfarctionAngiotensin-Converting Enzyme InhibitorsKaplan-Meier Estimate030204 cardiovascular system & hematologyVentricular Function Leftchemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineRetrospective StudieRisk FactorsClinical endpointOdds Ratiozofenopril030212 general & internal medicineMyocardial infarctionRandomized Controlled Trials as Topicleft ventricular dysfunctionMortality ratePharmacology; Cardiology and Cardiovascular MedicineMiddle AgedZofenoprilHospitalizationTreatment OutcomeCardiologyOriginal ArticleDrug Therapy CombinationFemaleCardiology and Cardiovascular MedicineHumanmedicine.drugRamiprilmedicine.medical_specialtyLogistic ModelTime FactorSystoleacute myocardial infarctionramiprilDisease-Free SurvivalDrug Administration ScheduleFollow-Up Studie03 medical and health sciencesStatistical significanceInternal medicineEarly Medical InterventionmedicineHumansIntensive care medicineAgedRetrospective StudiesPharmacologyChi-Square DistributionAspirinbusiness.industryRisk FactorAngiotensin-Converting Enzyme InhibitorOdds ratioRecovery of Functionmedicine.diseaseConfidence intervalLogistic ModelschemistryClinical Trials Phase III as Topicbusinessacetyl salicylic acidFollow-Up StudiesJournal of Cardiovascular Pharmacology
researchProduct

The association of uric acid with mortality modifies at old age: data from the uric acid right for heart health (URRAH) study

2021

Objectives: In older individuals, the role of serum uric acid (SUA) as risk factor for mortality is debated. This study investigated the association of SUA with all-cause and cardiovascular (CV) mortality in older adults participating in the large multicentre observational uric acid right for heart health (URRAH) study. Methods: Eight thousand URRAH participants aged 65+ were included in the analysis. The predictive role of SUA was assessed using Cox regression models stratified according to the cut-off age of 75. SUA was tested as continuous and categorical variable (age-specific quartiles). The prognostic threshold of SUA for mortality was analysed using receiver operating characteristic …

Settore MED/09 - Medicina InternahypertensionPhysiologyAged; Humans; Prognosis; Proportional Hazards Models; Risk Factors; Uric Aciduric acid; hypertension; elderly; cardiovascular prevention; stroke; myocardial infarctionAcid Urc mortality old agePrognosisCardiovascular riskelderlystrokeolder adultCardiovascular preventionmyocardial infarctionRisk FactorsOlder adultsCardiovascular prevention; Cardiovascular risk; Mortality; Older adults; Uric acidInternal MedicineHumansMortalityCardiology and Cardiovascular MedicineUric acidAgedProportional Hazards Models
researchProduct

Short-Term Effects of a Combined Nutraceutical on Lipid Level, Fatty Liver Biomarkers, Hemodynamic Parameters, and Estimated Cardiovascular Disease R…

2017

Introduction: There is a growing interest in nutraceuticals improving cardiovascular risk factor levels and related organ damage. Methods: This double-blind, placebo-controlled randomized clinical trial aims to compare the effect of a combined nutraceutical containing red yeast rice (10 mg), phytosterols (800 mg), and l-tyrosol (5 mg) on lipid profile, blood pressure, endothelial function, and arterial stiffness in a group of 60 patients with polygenic hypercholesterolemia resistant to Mediterranean diet. Results: After 8 weeks of treatment, when compared to the placebo group, the active treated patients experienced a more favorable percentage change in total cholesterol (−16.3% vs 9.9…

MaleBlood Pressure030204 cardiovascular system & hematologyGastroenterologychemistry.chemical_compoundDietary supplement0302 clinical medicineRisk FactorsPhytosterolPharmacology (medical)030212 general & internal medicineEndothelial dysfunctionOriginal ResearchFramingham Risk Scoremedicine.diagnostic_testAnticholesteremic AgentsFatty liverPhytosterolsGeneral MedicineMiddle AgedDietary supplementsCholesterolBiochemistryCardiovascular DiseasesFemaleNutraceuticalsNutraceuticalAdultmedicine.medical_specialtyl-TyrosolHypercholesterolemiaPlacebo03 medical and health sciencesDouble-Blind MethodInternal medicinemedicineHumansRisk factorBiological ProductsCholesterolbusiness.industryHemodynamicsmedicine.diseaseCardiovascular disease riskBlood pressurechemistryRed yeast riceArterial stiffnessLipid profilebusinessBiomarkers
researchProduct

What changed in the Italian internal medicine and geriatric wards during the lockdown

2021

A total of 48 internal medicine or geriatric wards among the 93 adhering to the register REPOSI answered an online questionnaire aimed to investigate the characteristics and activities of converted and non-converted wards in the crucial period of the first wave of the epidemic, 22 February-4 May 2020

2019-20 coronavirus outbreakCoronavirus disease 2019 (COVID-19)Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)Aged; Humans; Italy; Hospitals; Internal MedicineMEDLINEgeriatricSocio-culturalelaw.inventionlockdownHospitalPatient TransportlawPandemicHospital dischargemedicineInternal MedicineAged Hospitals Humans Internal Medicine ItalyHumansLetter to the EditorInternal medicineAgedLS7_9business.industrygeriatric patientsmedicine.diseaseIntensive care unitHospitalsInternal medicine geriatric patients lockdown covid-19Italycovid-19Medical emergencybusinessHuman
researchProduct

Renal artery denervation for treating resistant hypertension: Definition of the disease, patient selection and description of the procedure

2012

Arterial hypertension is responsible for a significant burden of cardiovascular morbidity and mortality, worldwide. Although several rational and integrated pharmacological strategies are available, the control of high blood pressure still remains largely unsatisfactory. Failure to achieve effective blood pressure control in treated hypertensive patients may have a substantial impact on individual global cardiovascular risk, since it significantly increases the risk of developing hypertension-related macrovascular and microvascular complications. Arterial hypertension is arbitrarily defined as 'resistant' or 'refractory' when the recommended blood pressure goals (clinic blood pressure below…

medicine.medical_specialtySympathetic nervous systemSettore MED/09 - Medicina InternahypertensionDrug ResistanceFemoral arteryRisk AssessmentNephropathyPharmacotherapyRenal ArteryRisk Factorsmedicine.arteryInternal medicinemedicineInternal MedicineHumansArterial PressureRenal arterySympathectomyrenal artery denervationglobal cardiovascular riskantihypertensive therapyAntihypertensive AgentsSettore MED/14 - NefrologiaDenervationrefractory hypertensiontreatmentbusiness.industryPatient SelectionType 2 Diabetes Mellitusresistant hypertensionmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato Cardiovascolaremedicine.anatomical_structureBlood pressureTreatment Outcomeresistant hypertension refractory hypertension renal artery denervation antihypertensive therapy global cardiovascular risk.resistant-hypertension; treatment; hypertensionCardiologyCatheter AblationHypertension treatment; Resistant-hypertension treatment; Antihypertensive Agents; Humans; Hypertension; Patient Selection; Renal Artery; Risk Assessment; Risk Factors; Sympathectomy; Treatment Outcome; Arterial Pressure; Catheter Ablation; Drug Resistance; Internal Medicine; Cardiology and Cardiovascular MedicinebusinessCardiology and Cardiovascular Medicineresistant-hypertension
researchProduct

Identification of a plausible serum uric acid cut-off value as prognostic marker of stroke: the Uric Acid Right for Heart Health (URRAH) study

2021

The Working Group on Uric Acid and Cardiovascular Risk of the Italian Society of Hypertension conceived and designed an ad hoc study aimed at searching for prognostic cut-off values of serum uric acid (SUA) in predicting combined (fatal and non-fatal) cerebrovascular (CBV) events in the whole database. The URic acid Right for heArt Health study is a nationwide, multicenter, observational cohort study involving data on subjects aged 18-95 years recruited on a regional community basis from all the territory of Italy under the patronage of the Italian Society of Hypertension with a mean follow-up period of 120.7 ± 61.8 months. A total of 14,588 subjects were included in the analysis. A prognos…

medicine.medical_specialtySettore MED/09 - Medicina Internauric acid cardiovascular riskserum uric acid; stroke; hypertension; cardiovascular prevention; cardiovascular diseasechemistry.chemical_compoundRisk FactorsInternal medicineDiabetes mellitusInternal MedicinemedicineHumansStrokeuric acid hypertensionbusiness.industryConfoundingPrognosismedicine.diseaseConfidence intervalUric AcidStrokechemistryHypertensionUric acidbusinessBody mass indexCohort studyKidney disease
researchProduct

Serum Uric Acid and Kidney Disease Measures Independently Predict Cardiovascular and Total Mortality: The Uric Acid Right for Heart Health (URRAH) Pr…

2021

Background: Serum uric acid predicts the onset and progression of kidney disease, and the occurrence of cardiovascular and all-cause mortality. Nevertheless, it is unclear which is the appropriate definition of hyperuricemia in presence of chronic kidney disease (CKD). Our goal was to study the independent impact of uric acid and CKD on mortality.Methods: We retrospectively investigated 21,963 patients from the URRAH study database. Hyperuricemia was defined on the basis of outcome specific cut-offs separately identified by ROC curves according to eGFR strata. The primary endpoints were cardiovascular and all-cause mortality.Results: After a mean follow-up of 9.8 year, there were 1,582 (7.2…

medicine.medical_specialtyhyperuricemiaCardiovascular Medicineurologic and male genital diseasesGastroenterologyalbuminuriachemistry.chemical_compoundcardiovascular mortalityInternal medicinemedicineeGFRDiseases of the circulatory (Cardiovascular) systemHyperuricemiaRisk factorOriginal Researchbusiness.industryIncidence (epidemiology)Confoundingalbuminuria; all-cause mortality; cardiovascular mortality; eGFR; hyperuricemiahyperuricemia eGFR albuminuria cardiovascular mortality all-cause mortalitymedicine.diseasechemistryQuartileRC666-701AlbuminuriaUric acidall-cause mortalitymedicine.symptomCardiology and Cardiovascular MedicinebusinessKidney disease
researchProduct

Age and Multimorbidity Predict Death Among COVID-19 Patients: Results of the SARS-RAS Study of the Italian Society of Hypertension

2020

Several factors have been proposed to explain the high death rate of the coronavirus disease 2019 (COVID-19) outbreak, including hypertension and hypertension-related treatment with Renin Angiotensin System inhibitors. Also, age and multimorbidity might be confounders. No sufficient data are available to demonstrate their independent role. We designed a cross-sectional, observational, multicenter, nationwide survey in Italy to verify whether renin-angiotensin system inhibitors are related to COVID-19 severe outcomes. We analyzed information from Italian patients diagnosed with COVID-19, admitted in 26 hospitals. One thousand five hundred ninety-one charts (male, 64.1%; 66±0.4 years) were r…

MaleCross-sectional studyAngiotensin-Converting Enzyme Inhibitors030204 cardiovascular system & hematologyRenin-Angiotensin System0302 clinical medicine80 and overMedicineodds ratioodds ratio.030212 general & internal medicineViralYoung adultSocieties MedicalAged 80 and overCOVID-19; hypertension; Italy; multimorbidity; odds ratio; Adolescent; Adult; Age Distribution; Age Factors; Aged; Aged 80 and over; Angiotensin Receptor Antagonists; Angiotensin-Converting Enzyme Inhibitors; Coronavirus Infections; Cross-Sectional Studies; Female; Humans; Hypertension; Italy; Male; Middle Aged; Multimorbidity; Pandemics; Pneumonia Viral; Prognosis; Renin-Angiotensin System; Survival Rate; Young Adult; Betacoronavirus; Societies MedicalMortality rateAge FactorsMiddle AgedPrognosisSurvival RateItalyCOVID-19; hypertension; Italy; multimorbidity; odds ratioFemaleCoronavirus InfectionsAdultmedicine.medical_specialtyhypertensionAdolescentmultimorbidityPneumonia ViralCOVID-19; Italy; hypertension; multimorbidity; odds ratio03 medical and health sciencesAngiotensin Receptor AntagonistsYoung AdultBetacoronavirusAge DistributionInternal medicineDiabetes mellitusMedicalInternal MedicineHumansSurvival ratePandemicsAgedbusiness.industrySARS-CoV-2COVID-19Odds ratioPneumoniamedicine.diseaseCross-Sectional StudiesHeart failureCOVID-19; Hypertension; Italy; Multimorbidity; Odds ratio; Adolescent; Adult; Age Distribution; Age Factors; Aged; Aged 80 and over; Angiotensin Receptor Antagonists; Angiotensin-Converting Enzyme Inhibitors; COVID-19; Coronavirus Infections; Cross-Sectional Studies; Female; Humans; Hypertension; Italy; Male; Middle Aged; Multimorbidity; Pandemics; Pneumonia Viral; Prognosis; Renin-Angiotensin System; SARS-CoV-2; Survival Rate; Young Adult; Betacoronavirus; Societies MedicalbusinessSocietiesKidney disease
researchProduct

Zofenopril and ramipril in patients with left ventricular systolic dysfunction after acute myocardial infarction: A propensity analysis of the Surviv…

2016

Introduction: This was a propensity score analysis of the prospective, randomized, double-blind Survival of Myocardial Infarction Long-term Evaluation (SMILE) 4 study in which one-year treatment with zofenopril 60 mg plus acetylsalicylic acid (ASA) 100 mg gave superior results compared to ramipril 10 mg plus ASA in terms of death or hospitalization for cardiovascular causes in patients with acute myocardial infarction (AMI) complicated by left ventricular dysfunction (LVD). Materials and methods: A total of 716 patients of the intention-to-treat population were divided into homogeneous propensity quintiles (Q) using a logistic regression model (QI: best risk profile; QV: worst risk profile)…

MaleMedicine (General)Time FactorsCaptoprilIntention to Treat AnalysiLeftMyocardial Infarction030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineEndocrinologyRamiprilPropensity analysisAcetylsalicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Left ventricular dysfunction; Propensity analysis; Captopril; Demography; Drug Therapy Combination; Endpoint Determination; Female; Hospitalization; Humans; Intention to Treat Analysis; Male; Middle Aged; Myocardial Infarction; Ramipril; Survival Analysis; Time Factors; Ventricular Dysfunction Left; Propensity Score; Internal Medicine; EndocrinologyVentricular DysfunctionMedicine030212 general & internal medicineMyocardial infarctioneducation.field_of_studyLeft ventricular dysfunctionElectrocardiography in myocardial infarctionMiddle AgedZofenoprilIntention to Treat AnalysisHospitalizationCombinationCardiologyOriginal ArticleDrug Therapy CombinationFemaleSurvival AnalysiPropensity analysimedicine.drugHumanRamiprilmedicine.medical_specialtyTime FactorEndpoint DeterminationPopulationAcute myocardial infarction03 medical and health sciencesR5-920Drug TherapyInternal medicineAngiotensin-converting enzyme inhibitorsAcetylsalicylic acidInternal MedicineHumanseducationPropensity ScoreDemographybusiness.industryOdds ratiomedicine.diseaseSurvival AnalysisConfidence intervalchemistryAngiotensin-converting enzyme inhibitorPropensity score matchingbusiness
researchProduct

Lipoprotein(a) Genotype Influences the Clinical Diagnosis of Familial Hypercholesterolemia

2023

: Background Evidence suggests that LPA risk genotypes are a possible contributor to the clinical diagnosis of familial hypercholesterolemia (FH). This study aimed at determining the prevalence of LPA risk variants in adult individuals with FH enrolled in the Italian LIPIGEN (Lipid Transport Disorders Italian Genetic Network) study, with (FH/M+) or without (FH/M-) a causative genetic variant. Methods and Results An lp(a) [lipoprotein(a)] genetic score was calculated by summing the number risk-increasing alleles inherited at rs3798220 and rs10455872 variants. Overall, in the 4.6% of 1695 patients with clinically diagnosed FH, the phenotype was not explained by a monogenic or polygenic cause …

cardiovascular risklipoprotein(a).familial hypercholesterolemia
researchProduct

Cost-effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post hoc analysis of SMI…

2013

Claudio Borghi,1 Ettore Ambrosioni,1 Stefano Omboni,2 Arrigo FG Cicero,1 Stefano Bacchelli,1 Daniela Degli Esposti,1 Salvatore Novo,3 Dragos Vinereanu,4 Giuseppe Ambrosio,5 Giorgio Reggiardo,6 Dario Zava7 1Unit of Internal Medicine, Policlinico S Orsola, University of Bologna, Bologna, Italy; 2Italian Institute of Telemedicine, Varese, Italy; 3Division of Cardiology, University of Palermo, Palermo, Italy; 4University and Emergency Hospital, Bucharest, Romania; 5Division of Cardiology, University of Perugia, Perugia, Italy; 6Mediservice, Milano, Italy; 7Istituto Lusofarmaco d'Italia SpA, Peschiera Borromeo, Italy Background: In SMILE-4 (the Survival of Myocardial Infarction Long-term…

Ramiprilmedicine.medical_specialtyCost effectivenessEconomics Econometrics and Finance (miscellaneous)Populationacute myocardial infarctionramiprilchemistry.chemical_compoundInternal medicinePost-hoc analysismedicinezofenoprilMyocardial infarctioneducationcost-effectivenesshealth care economics and organizationsOriginal Researchleft ventricular dysfunctioneducation.field_of_studylcsh:R5-920business.industryHealth Policylcsh:RM1-950acetylsalicylic acidmedicine.diseaseSMILE studycost effectiveness analysis (CEA)Confidence intervalZofenoprilangiotensin-converting enzyme inhibitorsClinicoEconomics and Outcomes Researchlcsh:Therapeutics. PharmacologychemistryCardiologyNumber needed to treatMedical emergencybusinesslcsh:Medicine (General)medicine.drug
researchProduct

Identification of the Uric Acid Thresholds Predicting an Increased Total and Cardiovascular Mortality Over 20 Years

2020

Serum uric acid (SUA) levels discriminating across the different strata of cardiovascular risk is still unknown. By utilizing a large population-based database, we assessed the threshold of SUA that increases the risk of total mortality and cardiovascular mortality (CVM). The URRAH study (Uric Acid Right for Heart Health) is a multicentre retrospective, observational study, which collected data from several large population-based longitudinal studies in Italy and subjects recruited in the hypertension clinics of the Italian Society of Hypertension. Total mortality was defined as mortality for any cause, CVM as death due to fatal myocardial infarction, stroke, sudden cardiac death, or heart…

Malemedicine.medical_specialtySettore MED/09 - Medicina Internaepidemiology; heart failure; humans; risk; uric acid; Cause of Death; Female; Humans; Italy; Male; Middle Aged; Mortality; Practice Patterns Physicians'; Quality Improvement; Risk Assessment; Risk Factors; Uric Acid; Cardiovascular Diseases; Hypertension; Hyperuricemiaheart failurePractice PatternsHyperuricemia030204 cardiovascular system & hematologyepidemiology; heart failure; humans; risk; uric acidRisk AssessmentSudden cardiac death03 medical and health sciences0302 clinical medicineuric acidRisk FactorsInternal medicineCause of DeathEpidemiologyInternal MedicineMedicine030212 general & internal medicineHyperuricemiaMyocardial infarctionhumanMortalityPractice Patterns Physicians'humansStrokeriskEpidemiology heart failure humans risk uric acid.Physicians'business.industryProportional hazards modelHazard ratioUric acid cardiovascular mortality epidemiologyMiddle Agedmedicine.diseaseQuality ImprovementItalyCardiovascular DiseasesHeart failureHypertensionFemaleepidemiologybusiness
researchProduct

Global perspective of familial hypercholesterolaemia: a cross-sectional study from the EAS Familial Hypercholesterolaemia Studies Collaboration (FHSC)

2021

Background The European Atherosclerosis Society Familial Hypercholesterolaemia Studies Collaboration (FHSC) global registry provides a platform for the global surveillance of familial hypercholesterolaemia through harmonisation and pooling of multinational data. In this study, we aimed to characterise the adult population with heterozygous familial hypercholesterolaemia and described how it is detected and managed globally. Methods Using FHSC global registry data, we did a cross-sectional assessment of adults (aged 18 years or older) with a clinical or genetic diagnosis of probable or definite heterozygous familial hypercholesterolaemia at the time they were entered into the registries. Dat…

MaleSettore MED/09 - Medicina InternaArterial diseaseCross-sectional studyAdult populationCoronary DiseaseDiseaseGlobal HealthMedical and Health SciencesDoenças Cardio e Cérebro-vascularesAnticholesteremic AgentMonoclonalPrevalenceRegistriesFamilial HypercholesterolemiaHumanizedStroke11 Medical and Health SciencesLS2_9Studies CollaborationAnticholesteremic AgentsGeneral MedicineHeart Disease Risk FactorMiddle AgedFHSC global registry dataEuropeTreatment OutcomeLower prevalenceGuidancelipids (amino acids peptides and proteins)FemaleProprotein Convertase 9Familial hypercholesterolaemiaLife Sciences & BiomedicineHumanAdultmedicine.medical_specialtyCombination therapyFHSC global registry heterozygous familial hypercholesterolaemiaCardiovascular risk factorsAntibodies Monoclonal HumanizedInsightsAntibodiesNOHyperlipoproteinemia Type IIClinicianMedicine General & InternalInternal medicineGeneral & Internal MedicineHealth SciencesmedicineHumansEAS Familial Hypercholesterolaemia Studies Collaboration (FHSC)Cross-Sectional StudieScience & TechnologyGlobal Perspectivebusiness.industryCholesterol LDLmedicine.diseaseCross-Sectional StudiesHeart Disease Risk FactorsHydroxymethylglutaryl-CoA Reductase InhibitorHydroxymethylglutaryl-CoA Reductase Inhibitorsbusiness
researchProduct

World Hypertension Day 2021 in Italy: Results of a Nationwide Survey

2022

Introduction: Hypertension is the biggest contributor to the global burden of cardiovascular diseases and related death, but the rates of hypertension awareness, treatment, and control remain largely perfectible. Methods: During the XVII World Hypertension Day (May 17th, 2021), a nationwide cross-sectional opportunistic study endorsed by the Italian Society of Hypertension was conducted on volunteer adults ≥ 18 years to raise awareness of high blood pressure (BP). A questionnaire on major demographic/clinical features (sex, age, employment, education, BP status awareness, hypertension family/personal history, antihypertensive medications use) and BP measurement habits (≥1 BP measurement in …

AdultMaleSettore MED/14 - Nefrologiaawareness; blood pressure; hypertension; surveySettore MED/09 - Medicina InternaSARS-CoV-2AwareneCOVID-19Middle AgedAwarenessCross-Sectional StudiesRisk FactorsSurveys and QuestionnairesAwareness Blood pressure Hypertension SurveyHypertensionInternal MedicineBlood pressureHumansFemaleAwareness; Blood pressure; Hypertension; Survey; Adult; Aged; Antihypertensive Agents; Cross-Sectional Studies; Female; Humans; Male; Middle Aged; Risk Factors; SARS-CoV-2; Surveys and Questionnaires; COVID-19; HypertensionCardiology and Cardiovascular MedicineSurveyAntihypertensive AgentsAged
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Hospital Care of Older Patients With COPD: Adherence to International Guidelines for Use of Inhaled Bronchodilators and Corticosteroids

2019

Abstract Objectives We aimed to analyze the prevalence and impact of COPD in older patients hospitalized in internal medicine or geriatric wards, and to investigate adherence to the Global Initiative for Chronic Obstructive Lung Disease (GOLD) guidelines, associated clinical factors, and outcomes. Design Data were obtained from REgistro POliterapie SIMI (REPOSI), a prospective multicenter observational registry that enrolls inpatients aged ≥65 years. Setting and Participants Older hospitalized patients enrolled from 2008 to 2016 with a diagnosis of COPD. Measures We evaluated adherence to the 2018 GOLD guidelines at admission and discharge, by examining the prescription of inhaled bronchodi…

Malemajor clinical eventmajor clinical eventsPulmonary Disease Chronic Obstructive0302 clinical medicineOlder patientsAdrenal Cortex Hormones80 and over030212 general & internal medicineLS4_4adherenceProspective StudiesGeneral NursingNursing (all)2901 Nursing (miscellaneous)Aged 80 and overCOPDHealth PolicyGeneral MedicineCOPD guidelines adherence major clinical events older patientsolder patientsObstructive lung diseaseBronchodilator Agentsguidelines adherenceHospitalizationInhalationCOPD; guidelines adherence; major clinical events; older patients; Administration Inhalation; Adrenal Cortex Hormones; Aged; Aged 80 and over; Bronchodilator Agents; Female; Humans; Male; Prospective Studies; Pulmonary Disease Chronic Obstructive; Guideline Adherence; HospitalizationAdministrationFemaleGuideline AdherenceCOPD guidelinesCOPD; guidelines adherence; major clinical events; older patients; Nursing (all)2901 Nursing (miscellaneous); Health Policy; Geriatrics and GerontologyChronic Obstructivemedicine.medical_specialtySocio-culturalePulmonary Disease03 medical and health sciencesolder patientInternal medicineAdministration InhalationmedicineHumansCOPDMedical prescriptionAgedPolypharmacybusiness.industrySettore MED/09 - MEDICINA INTERNAOdds ratiomedicine.diseaseConfidence intervalrespiratory tract diseasesCOPD; guidelines adherence; major clinical events; older patientsObservational studyGeriatrics and Gerontologybusiness030217 neurology & neurosurgery
researchProduct

Randomised comparison of zofenopril and ramipril plus acetylsalicylic acid in postmyocardial infarction patients with left ventricular systolic dysfu…

2015

Objective Conflicting evidence exists on the benefits of treating patients with coronary artery disease and preserved left ventricular ejection fraction (LVEF) with an ACE inhibitor. This retrospective analysis of the SMILE-4 Study sought to compare the efficacy of zofenopril 60 mg plus acetylsalicylic acid (ASA) versus ramipril 10 mg plus ASA 100 mg in patients with acute myocardial infarction (AMI) and heart failure, according to an impaired or preserved LVEF. Methods The primary study end point was 1-year combined occurrence of death or hospitalisation for cardiovascular causes. A preserved LVEF was defined by a baseline LVEF >40% and an impaired one by an LVEF ≤40%. Results 448 patients…

Ramiprilmedicine.medical_specialtyacute myocardial infarctionInfarctionramiprilCoronary Artery DiseaseCoronary artery diseasechemistry.chemical_compoundInternal medicinemedicinezofenopril1506cardiovascular diseasesMyocardial infarctionleft ventricular dysfunctionEjection fractionbusiness.industryleft ventricular ejection fractionmedicine.diseaseZofenoprilangiotensin-converting enzyme inhibitorsangiotensin-converting enzyme inhibitorchemistryacute myocardial infarction; angiotensin-converting enzyme inhibitors; left ventricular dysfunction; left ventricular ejection fractionHeart failureACE inhibitorcardiovascular systemCardiologyCardiology and Cardiovascular Medicinebusinesscirculatory and respiratory physiologyBiomedical engineeringmedicine.drugOpen Heart
researchProduct

Renin-Angiotensin System Inhibition in Cardiovascular Patients at the Time of COVID19: Much Ado for Nothing? A Statement of Activity from the Directo…

2020

Cardiovascular diseases, in particular hypertension, as well as the cardiovascular treatment with Renin-Angiotensin System inhibitors such as Angiotensin Converting Enzyme (ACE) inhibitors and Angiotensin Receptor Blockers (ARBs), are claimed once again as mechanisms of Severe Acute Respiratory Syndrome (SARS) during the COVID-19 outbreak due to Cov-2 epidemics. In vitro studies are available to support the eventual role of ACE inhibitors and ARBs in both the promotion and antagonism of the disease. The available literature, indeed, presents contrasting results, all concentrated in experimental models. Evidence in humans is lacking that those mechanisms are actually occurring in the present…

0301 basic medicineAngiotensin-Converting Enzyme InhibitorsDiseaseoutcomescardiovascular diseases; COVID-19; hypertension; infection; outcomes; Betacoronavirus; COVID-19; Cardiovascular Diseases; Humans; Hypertension; Italy; SARS-CoV-2; Angiotensin Receptor Antagonists; Angiotensin-Converting Enzyme Inhibitors; Antihypertensive Agents; Coronavirus Infections; Pandemics; Pneumonia Viral; Renin-Angiotensin SystemRenin-Angiotensin System0302 clinical medicinecardiovascular diseaseViralAngiotensin Receptor AntagonistsbiologyAngiotensin Receptor AntagonistAntihypertensive AgentItalyoutcomeAngiotensin Receptor BlockersCoronavirus InfectionsCardiology and Cardiovascular MedicineHumanmedicine.medical_specialtyhypertensionCoronavirus disease 2019 (COVID-19)Pneumonia ViralBetacoronavirusAngiotensin Receptor Antagonists03 medical and health sciencesPharmacotherapyRenin–angiotensin systemInternal MedicinemedicineHumansIntensive care medicinePandemicsAntihypertensive Agentsoutcomes.BetacoronaviruPandemicCoronavirus InfectionSARS-CoV-2business.industryOutbreakCOVID-19Angiotensin-Converting Enzyme InhibitorAngiotensin-converting enzymePneumoniacardiovascular diseases; COVID-19; hypertension; infection; outcomesinfectioncardiovascular diseases030104 developmental biologybiology.proteincardiovascular diseases; COVID-19; hypertension; infection; outcomes; betacoronavirus; cardiovascular diseases; humans; hypertension; Italy; angiotensin receptor antagonists; angiotensin-converting enzyme inhibitors; antihypertensive agents; coronavirus infections; pandemics; pneumonia viral; renin-angiotensin systembusiness030217 neurology & neurosurgery
researchProduct

Nutraceuticals and blood pressure control: A European Society of Hypertension position document

2020

: High-normal blood pressure (BP) is associated with an increased risk of cardiovascular disease, however the cost-benefit ratio of the use of antihypertensive treatment in these patients is not yet clear. Some dietary components and natural products seems to be able to significantly lower BP without significant side effects. The aim of this position document is to highlight which of these products have the most clinically significant antihypertensive action and wheter they could be suggested to patients with high-normal BP. Among foods, beetroot juice has the most covincing evidence of antihypertensive effect. Antioxidant-rich beverages (teas, coffee) could be considered. Among nutrients, …

Blood pressure controlPhysiologyPhysiologyDisease030204 cardiovascular system & hematologyResveratrolBeetroot JuiceAntioxidantsMelatoninBeveragesdietary supplements03 medical and health scienceschemistry.chemical_compoundPrehypertensionblood pressure; consensus; dietary supplements; food; nutraceuticals0302 clinical medicineNutraceuticalInternal MedicinemedicineHumansMagnesium030212 general & internal medicineAntihypertensive AgentsMelatoninBlood pressure consensus dietary supplements food nutraceuticalsnutraceuticalsVitamin Cbusiness.industryfoodblood pressureBlood pressurechemistryconsensusHypertensionPotassiumCardiology and Cardiovascular Medicinebusinessmedicine.drug
researchProduct

Uric acid is linked to cardiometabolic risk factors in overweight and obese youths.

2018

OBJECTIVE Observational studies have indicated that high levels of serum uric acid are associated with the risk of cardiovascular disease. The aim of the present study is to investigate the association of uric acid with individual cardiometabolic risk factors, as well as their degree of clustering, in overweight and moderate obese youth. METHODS Three hundred and thirty-three Caucasians of both sexes (149 women), from 5-18 years of age from those who underwent an assessment of overweight/obesity. Anthropometric parameters, office and 24-h blood pressure measurements and metabolic profile, including HDL-cholesterol, triglycerides, insulin, HOMA index and uric acid were assessed. RESULTS Uric…

MalePhysiologymedicine.medical_treatmentoffice blood pressureBlood Pressure030204 cardiovascular system & hematologyOverweightBody Mass Indexchemistry.chemical_compound0302 clinical medicineRisk FactorsInsulinChildyouthAnthropometryCardiovascular DiseasesChild PreschoolFemalemedicine.symptomWaist CircumferenceCardiology and Cardiovascular Medicinemedicine.medical_specialtyWaistAdolescentBirth weight030209 endocrinology & metabolism03 medical and health sciencesInternal medicineInternal MedicinemedicineHumanstriglycerideObesityRisk factorTriglyceridesbusiness.industryInsulinCholesterol HDLbirth weightnutritional and metabolic diseasesBlood Pressure DeterminationOverweightmedicine.diseaseObesityUric AcidEndocrinologyBlood pressurechemistryUric acidhigh-density lipoprotein-cholesterol24-h blood pressureInsulin ResistancebusinessJournal of hypertension
researchProduct

May Measurement Month 2018: an analysis of blood pressure screening results from Italy

2020

Abstract Cardiovascular (CV) diseases are burdened by high mortality and morbidity, being responsible for half of the deaths in Europe. Although hypertension is recognized as the most important CV risk factor, hypertension awareness and blood pressure (BP) control are still unsatisfactory. In 2017, 30.6% of a >10 000 individual sample who took part in the May Measurement Month (MMM) campaign in Italy was found to have high BP. To raise awareness on the hypertension issue and to report BP data on a nation-wide scale in Italy. In the frame of the MMM campaign, an opportunistic cross-sectional survey of volunteers aged ≥18 was carried out in May 2018. Blood pressure measurement, the def…

Mean arterial pressure030204 cardiovascular system & hematology03 medical and health sciences0302 clinical medicineDiabetes mellitusHealth careControlmedicineAcademicSubjects/MED00200030212 general & internal medicineRisk factor1102 Cardiorespiratory Medicine and HaematologyNational healthbusiness.industryHigh mortalityBlood pressure Control Hypertension Screening TreatmentArticlesmedicine.diseasehypertension; blood pressure; screening; treatment; controlTreatmentBlood pressureCardiovascular System & HematologyHypertensionBlood pressureScreeningCardiology and Cardiovascular MedicinebusinessBody mass indexBlood pressure; Control; Hypertension; Screening; TreatmentDemography
researchProduct

High heart rate amplifies the risk of cardiovascular mortality associated with elevated uric acid.

2021

Abstract Aims  Whether the association between uric acid (UA) and cardiovascular disease is influenced by some facilitating factors is unclear. The aim of this study was to investigate whether the risk of cardiovascular mortality (CVM) associated with elevated UA was modulated by the level of resting heart rate (HR). Methods and results  Multivariable Cox analyses were made in 19 128 participants from the multicentre Uric acid Right for heArt Health study. During a median follow-up of 11.2 years, there were 1381 cases of CVM. In multivariable Cox models both UA and HR, either considered as continuous or categorical variables were independent predictors of CVM both improving risk discriminat…

medicine.medical_specialtySympathetic nervous systemLongitudinal studyEpidemiologyHeart rate030204 cardiovascular system & hematologyCardiovascular03 medical and health scienceschemistry.chemical_compound0302 clinical medicineInternal medicineHeart rateSympathetic activityMedicine030212 general & internal medicineRisk factorMortalityProportional hazards modelbusiness.industryHazard ratioConfidence intervalmedicine.anatomical_structurechemistryCardiologyUric acidCardiovascular; Heart rate; Longitudinal study; Mortality; Sympathetic activity; Uric acidLongitudinal studyCardiology and Cardiovascular MedicinebusinessUric acidEuropean journal of preventive cardiology
researchProduct

A subgroup analysis of the ODYSSEY APPRISE study: Safety and efficacy of alirocumab in the Italian cohort.

2022

ODYSSEY APPRISE trial evaluated efficacy and safety of alirocumab in 994 patients with hypercholesterolemia and high CV risk in a real-life setting. The aim of the present report is to detail on the Italian cohort enrolled and treated in the trial.The methodology of the of the multinational, single-arm, Phase 3b open-label ODYSSEY APPRISE (Clinicaltrials.gov: NCT02476006) has been previously reported. 255 Italian patients were enrolled and treated according to the trial protocol. Overall mean exposure to alirocumab was 83.3 ± 27.7 weeks. At week 12, LDL-C decreased by 51.3 ± 23.1% and this reduction was overall maintained for the duration of the study. A similar reduction was observed in pa…

Settore MED/09 - Medicina InternaNutrition and DieteticsLDL-C.Endocrinology Diabetes and MetabolismAnticholesteremic AgentsMedicine (miscellaneous)alirocumabCholesterol LDLAntibodies Monoclonal HumanizedHyperlipoproteinemia Type IIheterozygous familial hypercholesterolemiaTreatment OutcomeItalyHumansheterozygous familial hypercholesterolemia; high cardiovascular risk; alirocumab; LDL-C; Italyhigh cardiovascular riskCardiology and Cardiovascular MedicineLDL-CNutrition, metabolism, and cardiovascular diseases : NMCD
researchProduct

Effect of pistachio on brachial artery diameter and flow-mediated dilatation: A systematic review and meta-analysis of randomized, controlled-feeding…

2017

Background: Results of previous clinical trials evaluating the effect of pistachio supplementation on endothelial reactivity (ER) are controversial. Aims: We aimed to assess the impact of pistachio on ER through systematic review of literature and meta-analysis of available randomized, controlled-feeding clinical studies (RCTs). Methods: The literature search included SCOPUS, PubMed-Medline, ISI Web of Science and Google Scholar databases up to 1st August 2017 to identify RCTs investigating the impact of pistachio on ER. Two independent reviewers extracted data on study characteristics, methods and outcomes. Overall, the impact of pistachio on ER was reported in 4 trials. Results: The meta-…

Isi web of sciencemedicine.medical_specialtyBrachial Artery030309 nutrition & dieteticsMEDLINEIndustrial and Manufacturing Engineeringbrachial artery diameter03 medical and health sciences0404 agricultural biotechnologyInternal medicinemedicine.arteryflow mediated dilatationmedicineHumansBrachial arteryPistachioRandomized Controlled Trials as Topic0303 health sciencesbusiness.industry04 agricultural and veterinary sciencesGeneral Medicine040401 food scienceDietendothelial reactivityStudy CharacteristicsSurgeryVasodilationmeta-analysisClinical trialSystematic reviewMeta-analysisPistaciaEndothelium VascularbusinessPublication BiasBlood Flow VelocityFood ScienceCritical Reviews in Food Science and Nutrition
researchProduct

May Measurement Month 2019: an analysis of blood pressure screening results from Italy.

2021

Abstract Cardiovascular (CV) diseases are burdened by high mortality and morbidity, being responsible for half of the deaths in Europe. Although hypertension is recognized as the most important CV risk factor, hypertension awareness, and blood pressure (BP) control are still unsatisfactory. In 2017 and 2018, respectively >10 000 and >5000 individuals took part in the May Measurement Month (MMM) campaign in Italy, of whom 30.6% and 26.3% were found to have high BP, respectively. To raise public awareness on the importance of hypertension and to collect BP data on a nation-wide scale in Italy. In the frame of the MMM campaign, an opportunistic cross-sectional survey of volunteer…

Mean arterial pressure030204 cardiovascular system & hematology03 medical and health sciencesHealth personnel0302 clinical medicineHealth campaignDiabetes mellitusControlMedicineBlood pressure Control Screening TreatmentAcademicSubjects/MED00200030212 general & internal medicineMyocardial infarctionRisk factorTreatment.1102 Cardiorespiratory Medicine and HaematologySettore MED/14 - Nefrologiabusiness.industryArticlesmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareTreatmentBlood pressureCardiovascular System & HematologyHypertensionBlood pressureScreeningCardiology and Cardiovascular MedicinebusinessBody mass indexBlood pressure; Control; Hypertension; Screening; TreatmentDemographyEuropean heart journal supplements : journal of the European Society of Cardiology
researchProduct

Obesity and Cardiometabolic Risk Factors : from Childhood to Adulthood

2021

Obesity has become a major epidemic in the 21st century. It increases the risk of dyslipidemia, hypertension, and type 2 diabetes, which are known cardiometabolic risk factors and components of the metabolic syndrome. Although overt cardiovascular (CV) diseases such as stroke or myocardial infarction are the domain of adulthood, it is evident that the CV continuum begins very early in life. Recognition of risk factors and early stages of CV damage, at a time when these processes are still reversible, and the development of prevention strategies are major pillars in reducing CV morbidity and mortality in the general population. In this review, we will discuss the role of well-known but also …

EpigenomicsMaleGerontologyPediatric ObesityobesityInfants Alimentacióobesity ; cardiometabolic risk factors ; hypertension ; dyslipidemia ; tracking phenomenon ; nutrigenomicsReviewType 2 diabetesnutrigenomicPregnancytracking phenomenon.TX341-641ChildPrenatal Nutritional Physiological PhenomenaMetabolic Syndromeeducation.field_of_studyNutrition and Dieteticscardiometabolic risk factorNutrigenomicsCardiorespiratory FitnessCardiovascular DiseasesChild PreschoolObesitatFemaleAdulttracking phenomenonhypertensionAdolescentPopulationChildhood obesityYoung AdultnutrigenomicsmedicineMortalitatHumansAdultseducationbusiness.industryNutrition. Foods and food supplydyslipidemiaInfant NewbornInfantCardiorespiratory fitnessmedicine.diseaseObesitycardiometabolic risk factorsDietMetabolic syndromebusinessDyslipidemiaFood Science
researchProduct

Serum uric acid levels threshold for mortality in diabetic individuals: The URic acid Right for heArt Health (URRAH) project

2022

Background and aim: The URRAH (URic acid Right for heArt Health) Study has identified cut-off values of serum uric acid (SUA) predictive of total mortality at 4.7 mg/dl, and cardiovascular (CV) mortality at 5.6 mg/dl. Our aim was to validate these SUA thresholds in people with diabetes. Methods and results: The URRAH subpopulation of people with diabetes was studied. All-cause and CV deaths were evaluated at the end of follow-up. A total of 2570 diabetic subjects were studied. During a median follow-up of 107 months, 744 deaths occurred. In the multivariate Cox regression analyses adjusted for several confounders, subjects with SUA ≥5.6 mg/dl had higher risk of total (HR: 1.23, 95%CI: 1.04-…

Diabetes mellituNutrition and DieteticsSettore MED/09 - Medicina InternaCardiovascular mortalitySerum uric acid Cardiovascular mortality All-cause mortality Diabetes mellitus Hyperuricemia Diagnostic thresholdsEndocrinology Diabetes and MetabolismMedicine (miscellaneous)HyperuricemiaAll-cause mortalityUric AcidDiagnostic thresholdsall-cause mortality; cardiovascular mortality; diabetes mellitus; diagnostic thresholds; hyperuricemia; serum uric acid; humans; risk factors; uric acid; diabetes mellitus; hyperuricemiaDiagnostic thresholdDiabetes mellitusSerum uric acidRisk FactorsAll-cause mortality; Cardiovascular mortality; Diabetes mellitus; Diagnostic thresholds; Hyperuricemia; Serum uric acidHumansCardiology and Cardiovascular Medicine
researchProduct

Serum uric acid, predicts heart failure in a large Italian cohort: search for a cut-off value the URic acid Right for heArt Health study

2020

Objective: To assess the prognostic cut-off values of serum uric acid (SUA) in predicting fatal and morbid heart failure in a large Italian cohort in the frame of the Working Group on Uric Acid and Cardiovascular Risk of the Italian Society of Hypertension. Methods: The URic acid Right for heArt Health (URRAH) study is a nationwide, multicentre, cohort study involving data on individuals aged 18-95 years, recruited on a community basis from all regions of Italy under the patronage of the Italian Society of Hypertension with a mean follow-up period of 128 ± 65 months. Incident heart failure was defined on the basis of International Classification of Diseases Tenth Revision codes and double-c…

medicine.medical_specialtySettore MED/09 - Medicina InternaPhysiologyEpidemiologyCut-off value030204 cardiovascular system & hematologyCohort Studies03 medical and health sciences0302 clinical medicineRisk FactorsInternal medicineDiabetes mellitusInternal MedicineMedicineHumans030212 general & internal medicineMortalityRisk factorCut-off value heart failure mortality uric acidHeart Failurebusiness.industryProportional hazards modelHazard ratioConfoundingcut-off value; heart failure; mortality; uric acidmedicine.diseaseUric AcidItalyHeart failureCohortHypertensionCardiologyCardiology and Cardiovascular MedicinebusinessCohort study
researchProduct

Efficacy and Safety of Zofenopril Versus Ramipril in the Treatment of Myocardial Infarction and Heart Failure: A Review of the Published and Unpublis…

2018

Zofenopril is a lipophilic, sulfhydryl group-containing angiotensin-converting enzyme (ACE)-inhibitor, characterized by wide tissue distribution, long duration of action, and pleiotropic effects on endothelial dysfunction. Its clinical efficacy and safety have been described in the four randomized controlled trials of the SMILE program, which globally enrolled more than 3600 patients in post-acute myocardial infarction (AMI) setting. The SMILE-4 study specifically selected patients with left ventricular dysfunction at admission, and compared the effects of zofenopril or ramipril in combination with acetylsalicylic acid (ASA). Zofenopril demonstrated its superiority over ramipril in reducing…

0301 basic medicineRamiprilmedicine.medical_specialtyCaptoprilPopulationMyocardial InfarctionCardiologyAngiotensin-Converting Enzyme InhibitorsHeart failureReviewAcute myocardial infarction030204 cardiovascular system & hematologylaw.inventionZofenopril03 medical and health scienceschemistry.chemical_compound0302 clinical medicineRandomized controlled trialDouble-Blind MethodRamiprillawInternal medicineAcute myocardial infarction; Angiotensin-converting enzyme inhibitors; Cardiology; Heart failure; Left ventricular dysfunction; Ramipril; Zofenopril; Pharmacology (medical)MedicineHumansPharmacology (medical)Myocardial infarctioneducationRandomized Controlled Trials as Topiceducation.field_of_studyLeft ventricular dysfunctionEjection fractionbusiness.industryGeneral Medicinemedicine.diseaseZofenopril030104 developmental biologyTreatment OutcomechemistryAngiotensin-converting enzyme inhibitorHeart failureCardiologyNumber needed to treatbusinessmedicine.drug
researchProduct

Prevalence of use and appropriateness of antidepressants prescription in acutely hospitalized elderly patients.

2019

Depression is often under-recognized in older patients, even if antidepressants (AD) are commonly prescribed, with a prevalence of use that increase with ageing [ 1 ]. Nevertheless, even if a diagnosis of depression is established, inappropriate treatment can occur [ 2 ]. Beers criteria are the most widely screening tools used to detect inappropriate prescription of drugs in people aged 65 years or more [ 3 ]. Since 2010, attempts to adapt the Beers' criteria have been made in Europe [ 4 , 5 ]. Tricyclic drugs are the ADs to be always avoided in the elderly, owing to their anticholinergic side effects, such as cognitive impairment, delirium, urinary retention and falls [ 3 ]. Selective sero…

Malemedicine.medical_specialtySocio-culturaleInappropriate Prescribing-Potentially inappropriate medication olderPractice Patternsdepression hospitalized patients drugselderlydrugsantidepressivi anzianoPolypharmacy | Inappropriate Prescribing | Medications PIMsantidepressant agent escitalopram paroxetineInternal MedicinemedicineHospital dischargeolderEscitalopramHumansLS4_4Medical prescriptionPractice Patterns Physicians'Depression (differential diagnoses)AgedPolypharmacySertralinePhysicians'antidepressantbusiness.industryTrazodonehospitalized patientsAntidepressive AgentsHospitalizationAcute Disease; Aged; Antidepressive Agents; Female; Humans; Inappropriate Prescribing; Italy; Male; Practice Patterns Physicians'; Hospitalizationantidepressants; elderlyItalyantidepressantsEmergency medicinedepressionAcute DiseasePolypharmacy Inappropriate Prescribing Medications PIMDeliriumFemalePotentially inappropriate medicationmedicine.symptombusinessmedicine.drugEuropean journal of internal medicine
researchProduct

Hyperuricaemia and gout in cardiovascular, metabolic and kidney disease

2020

During the last century, there has been an increasing prevalence of hyperuricaemia noted in many populations. While uric acid is usually discussed in the context of gout, hyperuricaemia is also associated with hypertension, chronic kidney disease, hypertriglyceridaemia, obesity, atherosclerotic heart disease, metabolic syndrome, and type 2 diabetes. Here we review the connection between hyperuricaemia and cardiovascular, kidney and metabolic diseases. Contrary to the popular view that uric acid is an inert metabolite of purine metabolism, recent studies suggest serum uric acid may have a variety of pro-inflammatory, pro-oxidative and vasoconstrictive actions that may contribute to cardiomet…

medicine.medical_specialtyGoutHeart diseaseAllopurinolAllopurinolHyperuricemiaType 2 diabetes030204 cardiovascular system & hematologyurologic and male genital diseasesCoronary artery disease03 medical and health scienceschemistry.chemical_compoundFebuxostat0302 clinical medicineInternal medicineInternal MedicinemedicineHumans030212 general & internal medicineMetabolic SyndromeType 2 diabetes.business.industrynutritional and metabolic diseasesmedicine.diseaseUric AcidGoutDiabetes Mellitus Type 2chemistryHypertensionCardiologyUric acidMetabolic syndromebusinessHyperuricaemiaKidney diseasemedicine.drugEuropean Journal of Internal Medicine
researchProduct

Zofenopril is a cost-effective treatment for patients with left ventricular systolic dysfunction following acute myocardial infarction: a pharmacoeco…

2013

Objective: The Survival of Myocardial Infarction Long-term Evaluation 4 Study (SMILE-4) showed the superiority of Zofenopril (Z) associated with Acetylsalicylic Acid (ASA) as respect to Ramipril (R) plus ASA in reducing the occurrence of major cardiovascular events, in patients with left ventricular dysfunction (LVD) following Acute Myocardial Infarction (AMI). The objective of this retrospective analysis was the evaluation of cost-effectiveness of Z compared to R. Methods: 771 patients with LVD and AMI were randomized, double-blind to Z 60 mg/day (n=389) or R 10 mg/day (n=382) plus ASA 100 mg/day and followed-up for 1 year. The primary study end-point was 1-year combined occurrence of deat…

RamiprilPediatricsmedicine.medical_specialtyeducation.field_of_studybusiness.industryCost effectivenessSurrogate endpointPopulationmedicine.diseaseConfidence intervalZofenoprilchemistry.chemical_compoundchemistryInternal medicinemedicineCardiologyNumber needed to treatMyocardial infarctionCardiology and Cardiovascular Medicinebusinesseducationhealth care economics and organizationsmedicine.drugEuropean Heart Journal
researchProduct

Appropriateness of oral anticoagulant therapy prescription and its associated factors in hospitalized older people with atrial fibrillation

2018

Aims Although oral anticoagulants (OACs) are effective in preventing stroke in older people with atrial fibrillation (AF), they are often underused in this particularly high-risk population. The aim of the present study was to assess the appropriateness of OAC prescription and its associated factors in hospitalized patients aged 65 years or older. Methods Data were obtained from the retrospective phase of Simulation-based Technologies to Improve the Appropriate Use of Oral Anticoagulants in Hospitalized Elderly Patients With Atrial Fibrillation (SIM-AF) study, held in 32 Italian internal medicine and geriatric wards. The appropriateness of OAC prescription was assessed, grouping patients in…

Pharmacologymedicine.medical_specialtyeducation.field_of_studybusiness.industryPopulationAtrial fibrillation030204 cardiovascular system & hematologymedicine.diseaseLogistic regression03 medical and health sciences0302 clinical medicineEmergency medicineAntithromboticmedicineOral anticoagulantPharmacology (medical)030212 general & internal medicineMedical prescriptionOlder peopleeducationbusinessStrokeBritish Journal of Clinical Pharmacology
researchProduct

Heart failure and chronic kidney disease in a registry of internal medicine wards

2014

Background: The aim of the present study was to evaluate the association between heart failure (HF) and chronic kidney disease (CKD) in tertiary care centers using the clinical records of patients enrolled in internal medicine departments.Patients and methods: We used the clinical records of 1380 elderly patients to identify patients with a history of HF and CKD using admission ICD codes and glomerular filtration rate (GFR) formulas. Magnitude and strength of such associations were investigated by univariable and multivariable analysis.Results: Of the 1380 patients enrolled, 27.9% had HF (age 80 ± 7, BMI 27 ± 6 kg/m2) and 17.4% CKD (age 81 ± 7, BMI 26.8 ± 6 kg/m2). Both groups were signific…

medicine.medical_specialtyChronic kidney disease; Elderly; Heart failure; REPOSI; Gerontology; Geriatrics and GerontologyHeart failure; Elderly; Chronic kidney disease; REPOSIChronic kidney disease; Elderly; Heart failure; REPOSI; Humans; Sleep Apnea Syndromes; Noninvasive Ventilation; Gerontology; Geriatrics and GerontologyChronic kidney disease; Elderly; Heart failure; REPOSIRenal functionHeart failure; chronic kidney disease; elderly; registry; REPOSIHeart failureregistryTertiary careSleep Apnea SyndromeElderlySleep Apnea SyndromesInternal medicineChronic kidney diseaseEpidemiologymedicineHumansNoninvasive Ventilationbusiness.industryREPOSIChronic kidney disease; Elderly; Heart failure; REPOSI; Humans; Sleep Apnea Syndromes; Noninvasive Ventilation; Geriatrics and Gerontology; Gerontologymedicine.diseaseHeart failureHeart failure Elderly Chronic kidney disease REPOSIIcd codesGeriatrics and GerontologybusinessClinical recordBody mass indexGerontologyKidney diseaseHuman
researchProduct

Choice and Outcomes of Rate Control versus Rhythm Control in Elderly Patients with Atrial Fibrillation: A Report from the REPOSI Study

2018

Background: Among rate-control or rhythm-control strategies, there is conflicting evidence as to which is the best management approach for non-valvular atrial fibrillation (AF) in elderly patients. Design: We performed an ancillary analysis from the ‘Registro Politerapie SIMI’ study, enrolling elderly inpatients from internal medicine and geriatric wards. Methods: We considered patients enrolled from 2008 to 2014 with an AF diagnosis at admission, treated with a rate-control-only or rhythm-control-only strategy. Results: Among 1114 patients, 241 (21.6%) were managed with observation only and 122 (11%) were managed with both the rate- and rhythm-control approaches. Of the remaining 751 patie…

MaleAnti-Arrhythmia Agents/therapeutic useantiarrhythmic agentComorbidityAged; Aged 80 and over; Anti-Arrhythmia Agents; Atrial Fibrillation; Comorbidity; Diabetes Mellitus; Female; Heart Failure; Heart Rate; Hospitalization; Humans; Male; Odds Ratio; Polypharmacy; Prevalence; Geriatrics and Gerontology; Pharmacology (medical)030204 cardiovascular system & hematologyanticoagulant agentDiabetes Mellitus/drug therapy0302 clinical medicineHeart RateAtrial Fibrillation80 and overOdds RatioPrevalencePharmacology (medical)030212 general & internal medicineLS4_4Aged 80 and overantiarrhythmic agent anticoagulant agent antithrombocytic agent calcium channel blocking agent digoxinHeart Rate/drug effectsDiabetes MellituAtrial fibrillationantithrombocytic agentdigoxinHospitalizationAnti-Arrhythmia AgentFemaleAnti-Arrhythmia AgentsHumanmedicine.medical_specialtySocio-culturale-Geriatrics and Gerontology; Pharmacology (medical)03 medical and health sciencesInternal medicineDiabetes mellitusHeart rateantiarrhythmic agent; anticoagulant agent; antithrombocytic agent; calcium channel blocking agent; digoxinmedicineDiabetes MellitusHumansAgedPolypharmacyHeart Failurebusiness.industryAtrial Fibrillation/drug therapyOdds ratiomedicine.diseaseHeart Failure/drug therapyComorbidityConfidence intervalcalcium channel blocking agentHeart failurePolypharmacyAged; Aged 80 and over; Anti-Arrhythmia Agents; Atrial Fibrillation; Comorbidity; Diabetes Mellitus; Female; Heart Failure; Heart Rate; Hospitalization; Humans; Male; Odds Ratio; Polypharmacy; PrevalenceGeriatrics and Gerontologybusiness
researchProduct

May Measurement Month 2018: a pragmatic global screening campaign to raise awareness of blood pressure by the International Society of Hypertension.

2019

Abstract Aims Raised blood pressure (BP) is the biggest contributor to mortality and disease burden worldwide and fewer than half of those with hypertension are aware of it. May Measurement Month (MMM) is a global campaign set up in 2017, to raise awareness of high BP and as a pragmatic solution to a lack of formal screening worldwide. The 2018 campaign was expanded, aiming to include more participants and countries. Methods and results Eighty-nine countries participated in MMM 2018. Volunteers (≥18 years) were recruited through opportunistic sampling at a variety of screening sites. Each participant had three BP measurements and completed a questionnaire on demographic, lifestyle, and envi…

MaleCardiac & Cardiovascular SystemsCross-sectional studyBlood Pressure030204 cardiovascular system & hematologyGlobal Burden of Disease0302 clinical medicineSurveys and QuestionnairesMMM InvestigatorsMass Screening030212 general & internal medicine1102 Cardiorespiratory Medicine and HaematologyAntihypertensive medicationRISKGlobalAwarenessMiddle AgedPREVALENCEHypertensionBlood pressureScreeningRaised blood pressureFemaleCardiology and Cardiovascular MedicineBURDENLife Sciences & BiomedicineControl; GlobalAdultmedicine.medical_specialtyFast Track Clinical ResearchOpportunistic Sampling03 medical and health sciencesInternal medicineControlmedicineSYSTEMATIC ANALYSISMANAGEMENTHumansMass screeningDisease burdenAntihypertensive AgentsScience & Technologybusiness.industryCase-control studyBlood Pressure DeterminationTreatmentEditor's ChoiceBlood pressureRAMADANCross-Sectional StudiesCardiovascular System & HematologyCase-Control StudiesCardiovascular System & CardiologybusinessHypertension Blood pressure Screening Global Treatment ControlEuropean heart journal
researchProduct

Zofenopril and Ramipril in Combination with Acetyl Salicylic Acid in Postmyocardial Infarction Patients with Left Ventricular Systolic Dysfunction: A…

2016

Summary Objective In the SMILE-4 study, zofenopril + acetyl salicylic acid (ASA) was more effective than ramipril + ASA on 1-year prevention of major cardiovascular events (MACE) in patients with acute myocardial infarction complicated by left ventricular dysfunction. In this retrospective analysis, we evaluated drug efficacy in subgroups of patients, according to a history of diabetes mellitus. Methods The primary study endpoint was 1-year combined occurrence of death or hospitalization for cardiovascular causes. Diabetes was defined according to medical history (previous known diagnosis). Results A total of 562 of 693 (81.0%) patients were classified as nondiabetics and 131 (18.9%) as dia…

MaleCaptoprilDiabetic CardiomyopathiesMyocardial InfarctionInfarctionAngiotensin-Converting Enzyme Inhibitors030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineDiabetes mellitusRamiprilRetrospective StudieCardiovascular DiseaseMedicinePharmacology (medical)030212 general & internal medicineMyocardial infarctionDiabetic CardiomyopathieRandomized Controlled Trials as TopicAspirinLeft ventricular dysfunctionGeneral MedicineAcetyl salicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Diabetes mellitus; Left ventricular dysfunction; Ramipril; Zofenopril; Cardiology and Cardiovascular Medicine; Pharmacology (medical); PharmacologyMiddle AgedZofenoprilAcetyl salicylic acidCardiovascular DiseasesCardiologyPlatelet aggregation inhibitorDrug Therapy CombinationFemaleCardiology and Cardiovascular Medicinemedicine.drugHumanRamiprilmedicine.medical_specialtyDiabetes mellituSystoleAcute myocardial infarctionZofenopril03 medical and health sciencesDiabetes mellitusInternal medicineHumansAgedRetrospective StudiesPharmacologyAspirinbusiness.industryPlatelet Aggregation InhibitorAngiotensin-Converting Enzyme Inhibitormedicine.diseasechemistryAngiotensin-converting enzyme inhibitorbusinessMacePlatelet Aggregation Inhibitors
researchProduct

Diagnostic and Therapeutic Approach to Sleep Disorders, High Blood Pressure and Cardiovascular Diseases. A Consensus Document by the Italian Society …

2021

Hypertension is a major contributor to fatal/nonfatal cardiovascular diseases, and timely identification and appropriate management of factors affecting hypertension and its control are mandatory public health issues. By inducing neurohormonal alterations and metabolic impairment, sleep disorders have an impact on a variety of cardiovascular risk factors, including hypertension, and ultimately increase the risk of cardiovascular events. There is evidence that qualitative and quantitative sleep disorders are associated with resistant hypertension and with impaired circadian blood pressure variations. However, sleep disturbances are often unrecognized, or heterogeneity exists in their managem…

0301 basic medicinemedicine.medical_treatmentSleep disorders.Comorbidity0302 clinical medicineCardiovascular DiseaseSleep Initiation and Maintenance DisordersInsomniaContinuous positive airway pressureSleep Apnea ObstructiveContinuous Positive Airway Pressureblood pressureHeart Disease Risk FactorPrognosisSleep in non-human animalsCircadian RhythmAntihypertensive AgentCardiovascular Diseasessleep disordersmedicine.symptomCardiology and Cardiovascular MedicineRisk assessmentHumancardiovascular riskmedicine.medical_specialtyConsensusSleep ApneahypertensionPrognosiConsensuRisk Assessment03 medical and health sciencesTherapeutic approachInternal MedicinemedicineHumansHealthy LifestyleIntensive care medicineConsensus DocumentAntihypertensive AgentsBlood pressure; Cardiovascular risk; Hypertension; Sleep disorders; Antihypertensive Agents; Blood Pressure; Cardiovascular Diseases; Circadian Rhythm; Comorbidity; Consensus; Healthy Lifestyle; Heart Disease Risk Factors; Humans; Hypertension; Prognosis; Risk Assessment; Risk Reduction Behavior; Sleep Apnea Obstructive; Sleep Initiation and Maintenance Disorders; Continuous Positive Airway Pressure; SleepSleep disorderbusiness.industryObstructivePublic healthmedicine.diseaseComorbidity030104 developmental biologyBlood pressureHeart Disease Risk Factorsblood pressure; cardiovascular risk; hypertension; sleep disordersbusinessSleepRisk Reduction Behavior030217 neurology & neurosurgery
researchProduct

Appropriateness of oral anticoagulant therapy prescription and its associated factors in hospitalized older people with atrial fibrillation

2018

Aims: Although oral anticoagulants (OACs) are effective in preventing stroke in older people with atrial fibrillation (AF), they are often underused in this particularly high-risk population. The aim of the present study was to assess the appropriateness of OAC prescription and its associated factors in hospitalized patients aged 65 years or older. Methods: Data were obtained from the retrospective phase of Simulation-based Technologies to Improve the Appropriate Use of Oral Anticoagulants in Hospitalized Elderly Patients With Atrial Fibrillation (SIM-AF) study, held in 32 Italian internal medicine and geriatric wards. The appropriateness of OAC prescription was assessed, grouping patients …

MaleOralappropriateness of prescriptionappropriateness of prescription atrial fibrillation internal medicine geriatric wards older patients oral anticoagulantSocio-culturaleAdministration OralHemorrhageInappropriate PrescribingDrug Prescriptionsinternal medicine and geriatric wardDose-Response Relationshipolder patientRisk Factorsoral anticoagulant80 and overHumansatrial fibrillationPharmacology (medical)Prospective StudiesAgedRetrospective StudiesAged 80 and overPharmacologygeriatric wardsDose-Response Relationship DrugSettore MED/09 - MEDICINA INTERNAAge FactorsAnticoagulantsinternal medicine and geriatric wardsOriginal Articlesolder patientsappropriateness of prescription; atrial fibrillation; internal medicine and geriatric wards; older patients; oral anticoagulant;appropriateness of prescription; atrial fibrillation; internal medicine and geriatric wards; older patients; oral anticoagulant; Pharmacology; Pharmacology (medical)Strokeinternal medicineappropriateness of prescription; atrial fibrillation; internal medicine and geriatric wards; older patients; oral anticoagulantAdministrationFemaleDrug
researchProduct

Spectrum of mutations in Italian patients with familial hypercholesterolemia: New results from the LIPIGEN study

2017

Abstract Background Familial hypercholesterolemia (FH) is an autosomal dominant disease characterized by elevated plasma levels of LDL-cholesterol that confers an increased risk of premature atherosclerotic cardiovascular disease. Early identification and treatment of FH patients can improve prognosis and reduce the burden of cardiovascular mortality. Aim of this study was to perform the mutational analysis of FH patients identified through a collaboration of 20 Lipid Clinics in Italy (LIPIGEN Study). Methods We recruited 1592 individuals with a clinical diagnosis of definite or probable FH according to the Dutch Lipid Clinic Network criteria. We performed a parallel sequencing of the major…

0301 basic medicineApolipoprotein ECandidate geneSettore MED/09 - Medicina InternaDatabases FactualApolipoprotein BDNA Mutational AnalysisFamilial hypercholesterolemia030204 cardiovascular system & hematologyCompound heterozygosityPCSK90302 clinical medicineRisk FactorsReceptorsGeneticsHomozygoteAutosomal dominant traitPathogenic variantsGeneral MedicinePrognosisAPOB; Familial hypercholesterolemia; LDLR; PCSK9; Pathogenic variantsCholesterolPhenotypeItalyAutosomal Recessive HypercholesterolemiaApolipoprotein B-100lipids (amino acids peptides and proteins)Proprotein Convertase 9APOBCardiology and Cardiovascular MedicinePreliminary DataGenetic MarkersFamilial hypercholesterolemiaLDLRPCSK9APOBPathogenic variantsHeterozygoteFamilial hypercholesterolemiaBiologyPathogenic variantLDLHyperlipoproteinemia Type II03 medical and health sciencesDatabasesmedicineInternal MedicineHumansAPOB; Familial hypercholesterolemia; LDLR; Pathogenic variants; PCSK9; Internal Medicine; Cardiology and Cardiovascular MedicineGenetic Predisposition to DiseaseFactualPCSK9Settore MED/13 - ENDOCRINOLOGIAAPOB; Familial hypercholesterolemia; LDLR; Pathogenic variants; PCSK9; Cardiology and Cardiovascular Medicine; Internal Medicinemedicine.diseaseAtherosclerosis030104 developmental biologyLDLRReceptors LDLMutationbiology.proteinAPOB; Familial hypercholesterolemia; LDLR; Pathogenic variants; PCSK9; Apolipoprotein B-100; Atherosclerosis; Cholesterol; DNA Mutational Analysis; Databases Factual; Genetic Markers; Genetic Predisposition to Disease; Heterozygote; Homozygote; Humans; Hyperlipoproteinemia Type II; Italy; Phenotype; Preliminary Data; Prognosis; Proprotein Convertase 9; Receptors LDL; Risk Factors; Mutation; Internal Medicine; Cardiology and Cardiovascular Medicine
researchProduct

Sex-Differences in the Pattern of Comorbidities, Functional Independence, and Mortality in Elderly Inpatients: Evidence from the RePoSI Register

2019

Background: The RePoSi study has provided data on comorbidities, polypharmacy, and sex dimorphism in hospitalised elderly patients. Methods: We retrospectively analysed data collected from the 2010, 2012, 2014, and 2016 data sets of the RePoSi register. The aim of this study was to explore the sex-differences and to validate the multivariate model in the entire dataset with an expanded follow-up at 1 year. Results: Among 4714 patients, 51% were women and 49% were men. The disease distribution showed that diabetes, coronary artery disease, chronic obstructive pulmonary disease, chronic kidney disease, and malignancy were more frequent in men but that hypertension, anaemia, osteoarthritis, de…

medicine.medical_specialtyMultivariate analysislcsh:MedicineSocio-culturaleDisease030204 cardiovascular system & hematologyelderlyArticleCoronary artery disease03 medical and health sciences0302 clinical medicineInternal medicineMedicine030212 general & internal medicineDepression (differential diagnoses)Polypharmacybusiness.industrylcsh:RGeneral Medicinemedicine.diseaseComorbidityelderly sex profiles disease distribution in-hospital mortality 3-month mortality 1-year mortalityMood disordersdisease distribution1-year mortality3-month mortalitysex profilesbusiness1-year mortality; 3-month mortality; disease distribution; elderly; in-hospital mortality; sex profilesKidney diseasein-hospital mortality
researchProduct

Pattern of comorbidities and 1-year mortality in elderly patients with COPD hospitalized in internal medicine wards: data from the RePoSI Registry

2020

Currently, chronic obstructive pulmonary disease (COPD) represents the fourth cause of death worldwide with significant economic burden. Comorbidities increase in number and severity with age and are identified as important determinants that influence the prognosis. In this observational study, we retrospectively analyzed data collected from the RePoSI register. We aimed to investigate comorbidities and outcomes in a cohort of hospitalized elderly patients with the clinical diagnosis of COPD. Socio-demographic, clinical characteristics and laboratory findings were considered. The association between variables and in-hospital, 3-month and 1-year follow-up were analyzed. Among 4696 in-patient…

Malemedicine.medical_specialtyChronic ObstructiveCirrhosisSocio-culturaleComorbidity030204 cardiovascular system & hematologycomorbiditieselderlyPulmonary Disease03 medical and health sciencesPulmonary Disease Chronic Obstructive0302 clinical medicineInternal medicinemedicine80 and overCOPDHumans030212 general & internal medicineLS4_4RegistriesHospital MortalityCOPD comorbidities elderly internal medicine in-hospital mortality.Depression (differential diagnoses)Cause of deathAgedRetrospective Studies1-year mortality; 3-month mortality; COPD; comorbidities; elderly; internal medicine; in-hospital mortalityAged 80 and overCOPDbusiness.industry1-year mortality; 3-month mortality; COPD comorbidities elderly internal medicine in-hospital mortalitymedicine.diseaseIm - Original1-year mortality; 3-month mortality; COPD comorbidities elderly internal medicine in-hospital mortality; Aged; Aged 80 and over; Comorbidity; Female; Humans; Internal Medicine; Male; Pulmonary Disease Chronic Obstructive; Registries; Retrospective Studies; Hospital Mortalityinternal medicineClinical diagnosisCohortEmergency Medicine1-year mortality3-month mortalityCOPD comorbidities elderly internal medicine in-hospital mortality1-year mortality 3-month mortality COPD comorbidities elderly internal medicine in-hospital mortality.Observational studyFemalebusiness1 year mortalityin-hospital mortality
researchProduct

Gender-differences in disease distribution and outcome in hospitalized elderly: data from the REPOSI study.

2014

none 330 Women live longer and outnumber men. On the other hand, older women develop more chronic diseases and conditions such as arthritis, osteoporosis and depression, leading to a greater number of years of living with disabilities. The aim of this study was to describe whether or not there are gender differences in the demographic profile, disease distribution and outcome in a population of hospitalized elderly people.Retrospective observational study including all patients recruited for the REPOSI study in the year 2010. Analyses are referred to the whole group and gender categorization was applied.A total of 1380 hospitalized elderly subjects, 50.5\% women and 49.5\% men, were conside…

GerontologyMaleActivities of daily livingSettore MED/09 - Medicina InternaGeriatric MedicineComorbidityDisease distribution; Elderly; Sex-gender difference; In-hospital mortalityDisease distribution; Elderly; In-hospital mortalityElderlyRetrospective StudieDisease distributionActivities of Daily Livinggender80 and overDepression (differential diagnoses)Aged 80 and overeducation.field_of_studyhospitalized elderlyDepressionMortality rateMedicine (all)gender hospitalization elderlyHospitalizationIn-hospital mortalityItalyoutcomeGeriatric Depression ScaleFemaleInpatientHumanPopulationGender-differencesex-gender differencesFollow-Up StudieCognition DisorderDisease distributionmedicineInternal MedicineDisease distribution; Elderly; In-hospital mortality; Sex-gender difference; Aged; Aged; 80 and over; Chronic Disease; Cognition Disorders; Comorbidity; Depression; Female; Follow-Up Studies; Geriatric Assessment; Hospitalization; Humans; Italy; Male; Morbidity; Retrospective Studies; Sex Distribution; Activities of Daily Living; Inpatients; Internal MedicineHumansDisease distribution; Elderly; In-hospital mortality; Sex-gender difference; Aged; Aged 80 and over; Chronic Disease; Cognition Disorders; Comorbidity; Depression; Female; Follow-Up Studies; Geriatric Assessment; Hospitalization; Humans; Italy; Male; Morbidity; Retrospective Studies; Sex Distribution; Activities of Daily Living; Inpatients; Internal MedicineSex DistributioneducationGeriatric AssessmentSex-gender differenceAgedRetrospective StudiesInpatientsbusiness.industrySettore MED/09 - MEDICINA INTERNARetrospective cohort studymedicine.diseaseComorbidityGender-differences; disease distribution; outcome; hospitalized elderlyIn-hospital mortalityElderlyMood disordersChronic DiseaseDisease distribution; Elderly; In-hospital mortality; Sex-gender difference; Aged; Aged 80 and over; Chronic Disease; Cognition Disorders; Comorbidity; Depression; Female; Follow-Up Studies; Geriatric Assessment; Hospitalization; Humans; Italy; Male; Morbidity; Retrospective Studies; Sex Distribution; Activities of Daily Living; Inpatientsdisease distribution; elderly; in-hospital mortality; sex-gender differencesMorbiditybusinessDisease distribution; Elderly; In-hospital mortality; Sex-gender difference; Aged; Aged 80 and over; Chronic Disease; Cognition Disorders; Comorbidity; Depression; Female; Follow-Up Studies; Geriatric Assessment; Hospitalization; Humans; Italy; Male; Morbidity; Retrospective Studies; Sex Distribution; Activities of Daily Living; Inpatients; Internal Medicine; Medicine (all)Cognition DisordersFollow-Up Studies
researchProduct

Clinical Characteristics and Outcomes of Patients with COVID-19 Infection: The Results of the SARS-RAS Study of the Italian Society of Hypertension

2021

: The COVID-19 infection has rapidly spread around the world and a second wave is sweeping in many countries. Different clinical and epidemiological aspects characterize the disease and their understanding is necessary to better face the management of the pandemic in progress. The Italian society of arterial hypertension with the SARS-RAS study has contributed significantly to the knowledge of the interaction between inhibition of the renin-angiotensin system and COVID-19 infection. Furthermore, the study results help to understand some of the main aspects related to mortality and morbidity deriving from the infection through a multicentre analysis throughout the national territory.

0301 basic medicineSettore MED/09 - Medicina InternaCross-sectional studyDiseaseComorbiditySeverity of Illness IndexComorbiditiesRenin-Angiotensin System0302 clinical medicineRisk FactorsSex-differences.EpidemiologyPandemicFrailtySars-Cov2Treatment OutcomeItalyAnti-hypertensive therapy; comorbidities; frailty; Sars-Cov2; sex-differencesHypertensionComorbiditiePosition PaperRisk assessmentCardiology and Cardiovascular Medicinemedicine.medical_specialtySex-differenceRisk Assessment03 medical and health sciencesPharmacotherapySex FactorsSeverity of illnessmedicineAnti-hypertensive therapy Sars-Cov2 Frailty Comorbidities Sex-differencesInternal MedicineHumansArterial PressureAnti-hypertensive therapy Comorbidities Frailty Sars-Cov2 Sex-differencesIntensive care medicineAnti-hypertensive therapyAntihypertensive AgentsAnti-hypertensive therapy; Comorbidities; Frailty; Sars-Cov2; Sex-differences; Antihypertensive Agents; Arterial Pressure; COVID-19; Comorbidity; Cross-Sectional Studies; Frailty; Humans; Hypertension; Italy; Renin-Angiotensin System; Risk Assessment; Risk Factors; Severity of Illness Index; Sex Factors; Treatment OutcomeSettore MED/14 - Nefrologiabusiness.industryCOVID-19medicine.diseaseComorbiditySex-differences030104 developmental biologyCross-Sectional Studiesbusiness030217 neurology & neurosurgery
researchProduct

Adherence to antithrombotic therapy guidelines improves mortality among elderly patients with atrial fibrillation: insights from the REPOSI study

2016

Background: Atrial fibrillation (AF) is associated with a substantial risk of thromboembolism and mortality, significantly reduced by oral anticoagulation. Adherence to guidelines may lower the risks for both all cause and cardiovascular (CV) deaths. Methods: Our objective was to evaluate if antithrombotic prophylaxis according to the 2012 European Society of Cardiology (ESC) guidelines is associated to a lower rate of adverse outcomes. Data were obtained from REPOSI; a prospective observational study enrolling inpatients aged ≥65 years. Patients enrolled in 2012 and 2014 discharged with an AF diagnosis were analysed. Results: Among 2535 patients, 558 (22.0 %) were discharged with a diagnos…

Antithrombotic therapy; Atrial fibrillation; Elderly; Guidelines; Outcomes; Cardiology and Cardiovascular MedicineMaleRegistrieTime Factorsantithrombotic therapy; atrial fibrillation; elderly; guidelines; outcomesAtrial fibrillation (AF)Practice PatternsKaplan-Meier Estimate030204 cardiovascular system & hematologyGuidelineoutcomesCoronary artery disease0302 clinical medicineElderlyRisk FactorsAtrial FibrillationAntithrombotic80 and overAge Factor030212 general & internal medicineRegistriesguidelinesAntithrombotic therapy Atrial fibrillation Elderly Guidelines OutcomesPractice Patterns Physicians'OutcomeAged 80 and overFibrinolytic AgentAge FactorsAtrial fibrillationGeneral MedicineTreatment OutcomeItalyAtrial fibrillation (AF) thromboembolism antithrombotic prophylaxisPractice Guidelines as TopicCardiologyFemaleGuideline AdherenceCardiology and Cardiovascular MedicineHumanAntithrombotic therapy; Atrial fibrillation; Elderly; Guidelines; Outcomes; Age Factors; Aged; Aged 80 and over; Atrial Fibrillation; Chi-Square Distribution; Female; Fibrinolytic Agents; Guideline Adherence; Humans; Italy; Kaplan-Meier Estimate; Logistic Models; Male; Practice Patterns Physicians'; Proportional Hazards Models; Registries; Risk Assessment; Risk Factors; Thromboembolism; Time Factors; Treatment Outcome; Practice Guidelines as Topic; Cardiology and Cardiovascular Medicinemedicine.medical_specialtyLogistic ModelTime FactorSocio-culturaleLower riskRisk Assessment03 medical and health sciencesFibrinolytic AgentsInternal medicineThromboembolismmedicineHumansProportional Hazards ModelsAgedAntithrombotic therapyPhysicians'Chi-Square Distributionbusiness.industryProportional hazards modelRisk FactorSettore MED/09 - MEDICINA INTERNAGuidelinethromboembolismmedicine.diseaseAtrial fibrillationLogistic ModelsProportional Hazards Modelantithrombotic prophylaxisbusinessChi-squared distributionFibrinolytic agent
researchProduct

Polypharmacy in older people: lessons from 10 years of experience with the REPOSI register

2018

As a consequence of population aging, we have witnessed in internal medicine hospital wards a progressive shift from a population of in-patients relatively young and mainly affected by a single ailment to one of ever older and more and more complex patients with multiple chronic diseases, followed as out-patients by many different specialists with poor integration and inevitably treated with multiple medications. Polypharmacy (defined as the chronic intake of five or more drugs) is associated with increased risks of drug-drug interactions and related adverse effects, prescription and intake errors, poor compliance, re-hospitalization and mortality. With this background, the Italian Society …

Malemedicine.medical_specialtyPopulation ageingDeprescribing; Inappropriate prescription; Medication reconciliation; Multimorbidity; PolypharmacyPopulationSocio-culturale030204 cardiovascular system & hematology03 medical and health sciences0302 clinical medicineDeprescribingRisk Factors80 and overDeprescribing; Inappropriate prescription; Medication reconciliation; Multimorbidity; Polypharmacy; Internal Medicine; Emergency MedicineInternal MedicinemedicineDeprescribing Inappropriate prescription Medication reconciliation Multimorbidity PolypharmacyHumansMultimorbidityRegistries030212 general & internal medicineMedical prescriptionAdverse effecteducationAgedAged 80 and overPolypharmacyGeriatricseducation.field_of_studybusiness.industryMultimorbidityPatient DischargeHospitalizationDeprescribing; Inappropriate prescription; Medication reconciliation; Multimorbidity; Polypharmacy; Aged; Aged 80 and over; Female; Geriatrics; Hospitalization; Humans; Italy; Male; Multimorbidity; Patient Discharge; Registries; Risk Factors; PolypharmacyItalyGeriatricsFamily medicinePolypharmacyEmergency MedicineMedication reconciliationFemaleDeprescribingbusinessDeprescribing; Inappropriate prescription; Medication reconciliation; Multimorbidity; Polypharmacy;Inappropriate prescriptionInternal and Emergency Medicine
researchProduct

Familial hypercholesterolemia: The Italian Atherosclerosis Society Network (LIPIGEN)

2017

Background and aims: Primary dyslipidemias are a heterogeneous group of disorders characterized by abnormal levels of circulating lipoproteins. Among them, familial hypercholesterolemia is the most common lipid disorder that predisposes for premature cardiovascular disease. We set up an Italian nationwide network aimed at facilitating the clinical and genetic diagnosis of genetic dyslipidemias named LIPIGEN (LIpid TransPort Disorders Italian GEnetic Network). Methods: Observational, multicenter, retrospective and prospective study involving about 40 Italian clinical centers. Genetic testing of the appropriate candidate genes at one of six molecular diagnostic laboratories serving as nationw…

0301 basic medicineCandidate geneGenetic testingSettore MED/09 - Medicina InternaDatabases FactualDNA Mutational AnalysisDiseaseFamilial hypercholesterolemia030204 cardiovascular system & hematology0302 clinical medicineDyslipidemias; Genetic testing; National network; Internal Medicine; Cardiology and Cardiovascular MedicineRisk FactorsProspective StudiesProgram DevelopmentProspective cohort studymedicine.diagnostic_testGeneral MedicinePrognosisCholesterolPhenotypeItalyCardiology and Cardiovascular MedicineGenetic Markersmedicine.medical_specialtyNational networkDyslipidemias; Genetic testing; National networkMEDLINEHyperlipoproteinemia Type II03 medical and health sciencesDatabasesInternal medicinemedicineInternal MedicineHumansGenetic Predisposition to DiseaseFactualGenetic testingRetrospective StudiesDyslipidemiasbusiness.industrySettore MED/13 - ENDOCRINOLOGIARetrospective cohort studymedicine.diseaseAtherosclerosisDyslipidemias; Genetic testing; National network; Atherosclerosis; Cholesterol; DNA Mutational Analysis; Databases Factual; Genetic Markers; Genetic Predisposition to Disease; Humans; Hyperlipoproteinemia Type II; Italy; Phenotype; Prognosis; Program Development; Prospective Studies; Retrospective Studies; Risk Factors; Mutation; Internal Medicine; Cardiology and Cardiovascular Medicine030104 developmental biologyEndocrinologyDyslipidemiaGenetic markerMutationbusiness
researchProduct